1TDJ


Conserved Protein Domain Family
IlvA

?
COG1171: IlvA 
Click on image for an interactive view with Cn3D
Threonine dehydratase [Amino acid transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 224092
View PSSM: COG1171
Aligned: 75 rows
Threshold Bit Score: 226.328
Threshold Setting Gi: 13476574
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TDJ       9 GAPEGAEYLRAVLR--APVYEAAQVTPLQKMEKLSSR-LDNVILVKREDRQP-VHSFKLRG-AYAM-----------MAG 72  Escherichia coli
2833403   20 TSPLFSQSQAKLARqfHQKIAGYRPTPLCALDDLANLfGVKKILVKDESKRFgLNAFKMLGgAYAIaqllcekyhldIET 99  Escherichia coli
2833403   20 TSPLFSQSQAKLARqfHQKIAGYRPTPLCALDDLANLfGVKKILVKDESKRFgLNAFKMLGgAYAIaqllcekyhldIET 99  Escherichia coli
2833403   20 TSPLFSQSQAKLARqfHQKIAGYRPTPLCALDDLANLfGVKKILVKDESKRFgLNAFKMLGgAYAIaqllcekyhldIET 99  Escherichia coli
15596048   1 ----mpFSLAALQQaaAIVHQSLPPTPQIRWPLLCEA-LGCEVWMKHENHLP-VGAFKLRG-GLVY-----------FHH 62  Pseudomonas aerugin...
15892551   1 -MNLLLQPPQNVAAahNRIKQYLHLTPIVHSESLNEM-LGHEIFFKVESLQK-TGAFKVRG-VLNH-----------LLE 65  Rickettsia conorii
15604314   1 -MNLLLQPPQNVAIahNRIKQYINLTPIIHSESLNAM-LGHEIFFKVESLQK-TGAFKIRG-VLNN-----------LLK 65  Rickettsia prowazekii
17865702  21 ALSLLNGNVGHEVLafHKKLPNYAVTPLHNLAHLSQRlGLGSIHIKDESWRFgLNAFKGLGgSYAVgkyladklqcdINS 100 Salmonella typhimurium
13541961   1 MSGWIRSELRDVIEveEIVRKQFLPSPLVSLNSNVVQ--GIETLLKLDNLLP-TGSFKVMG-STFL-----------IYK 65  Thermoplasma volcanium
13476574   1 ------------------------MTPLCALPALAREfGVGTIHVKDEGFRLgLGSFKALGgAYAVfrlvleeagkrLGR 56  Mesorhizobium loti
1TDJ      73 -LTEE---Q----KAHG---VITASAGNHAQGVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAK 141 Escherichia coli
2833403  100 -LSFEhlkNai-gEKMT---FATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRL 174 Escherichia coli
2833403  100 -LSFEhlkNai-gEKMT---FATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRL 174 Escherichia coli
2833403  100 -LSFEhlkNai-gEKMT---FATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRL 174 Escherichia coli
15596048  63 -LAHQg--E----RPAA---VISATRGNHGQSVAFSASRYGIQPIIVVPHGNSREKNAAMRSLGAELIEHGEDFQASREY 132 Pseudomonas aerugin...
15892551  66 -LKEQg--K----LPDK---IVGYSTGNHGIGLAYASKLFGIKTRIYLPLNTSKVKQQAALYYGGEVIYTYTRQEAEEKA 135 Rickettsia conorii
15604314  66 -LKEQe--K----LPDK---IVCYSSGNHGIGLAYSSKLFGIKTRIYLPLNTSKVKQQAALYYGGEVIYTNTRQEAESRA 135 Rickettsia prowazekii
17865702 101 -LSFAalnTpeikEKIKdcvFVTATDGNHGRGVAWAAEQLGLKAVVYMPKGSSLIRAENIRHHGAECTITDLNYDDAVRL 179 Salmonella typhimurium
13541961  66 -LNPD---E----IKAR---IIAASTGNFSQGXAYASRIYWIKVRIVMTDNSNPDNVDATRKLGGEVIFHGPKFNDARNY 134 Thermoplasma volcanium
13476574  57 pVDVEdldRadvrSVAAkmtFACATDGNHGRSVAQGAELAGARAVIFVHAGVSDERISAIARYGAEMVRVNGNYDDSVRQ 136 Mesorhizobium loti
1TDJ     142 AIELSQQQGFTWVPPFD-------HPMVIAGQGTLALELLQQDAH-----LDRVFVPVGGGGLAAGVAVLIKQLMPQ--I 207 Escherichia coli
2833403  175 TMQHAQQHGWEVVQDTAwegytkiPTWIMQGYATLADEAVEQMREmg-vtPTHVLLQAGVGAMAGGVLGYLVDVYSPqnL 253 Escherichia coli
2833403  175 TMQHAQQHGWEVVQDTAwegytkiPTWIMQGYATLADEAVEQMREmg-vtPTHVLLQAGVGAMAGGVLGYLVDVYSPqnL 253 Escherichia coli
2833403  175 TMQHAQQHGWEVVQDTAwegytkiPTWIMQGYATLADEAVEQMREmg-vtPTHVLLQAGVGAMAGGVLGYLVDVYSPqnL 253 Escherichia coli
15596048 133 AAERARREGLHLIPAF--------HPWLVAGVASYSLELFAALADl-----DEVYVPIGMGSGICGLIAARDALGLK--T 197 Pseudomonas aerugin...
15892551 136 KE--DEKQGFYYMHPSD-------SDSTIAGAGTLCYEALQQLGFs----PDAIFASCGGGGLISGAYLAKELISPT--S 200 Rickettsia conorii
15604314 136 KA--DEEQGFYYMHPSD-------SDSIIAGAGTLCYEALQQLGFs----PDAIFASCGGGGLISGSYLAKELISPT--S 200 Rickettsia prowazekii
17865702 180 AHRMAQTKGWVLLQDTAwtgyeeiPTWIMQGYMTLAVEAYEQLAEtnsplPTHLILQAGVGSFAGSVMGYFVEKMQEniP 259 Salmonella typhimurium
13541961 135 AEELAVKNGYRYFHSAN-------EPLLVAGVGTHTPELIESDPEi-----DAIIVPVGDESGSRGAAIVAETMSKD--I 200 Thermoplasma volcanium
13476574 137 AAQVAAEKGWSVVSDTSwpgyeriPGLVMQGYTAIVREALRQLSEp----PTHVFVQAGVGGIAAAVAGHLAIVLGDarP 212 Mesorhizobium loti
1TDJ     208 KVIAVEAEDSACLKAALDA--G-HPVDLPRVGLFAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFED---- 280 Escherichia coli
2833403  254 HSIIVEPDKADCIYRSGVK--GdIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPyg-n 330 Escherichia coli
2833403  254 HSIIVEPDKADCIYRSGVK--GdIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPyg-n 330 Escherichia coli
2833403  254 HSIIVEPDKADCIYRSGVK--GdIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPyg-n 330 Escherichia coli
15596048 198 RIVGVVSAHAPAYALSFEA--GtAISHPV-DTRLADGMACSTPDPSALEMILAGADRLVRVSDREIGAAMRLCFTS---- 270 Pseudomonas aerugin...
15892551 201 LLIGSEPLNANDAYLSVKD--NkTYRFNYAPNTIADGLKTLSISARTFEYLKKLDD-FYLAEEYEIYYWTAWLTHL---- 273 Rickettsia conorii
15604314 201 LLIGSEPVAANDAYLSIKN--NnIYRFNDSPITIADGLKTLSVSARTFEYLKKLDH-FYLAEEYEIYYWTAWLTHL---- 273 Rickettsia prowazekii
17865702 260 NIIVVEPHQANCLYQSAVMddGqPHCVTGDMATIMAGLACGEPNIISWPIIRDNTSCFISADDCLAAKGMRISAAPrpgt 339 Salmonella typhimurium
13541961 201 KVIGAQSEMFPAAYKARKS--GvHE------------------------------------------------------- 223 Thermoplasma volcanium
13476574 213 TFIVVEPARAACIVAAARA--GhVVKVAHDQPTVMAMLECYEASQVAWRVLARVADAFMTVDEHDAVAVMRRLARPag-s 289 Mesorhizobium loti
1TDJ     281 -VRAVAEPSGALALAGMKKYIALHn-IRGER----LAHILSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGS 351 Escherichia coli
2833403  331 dPRIISGESGAVGLGVLAAVHYHPq-RQS------LMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP-- 398 Escherichia coli
2833403  331 dPRIISGESGAVGLGVLAAVHYHPq-RQS------LMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP-- 398 Escherichia coli
2833403  331 dPRIISGESGAVGLGVLAAVHYHPq-RQS------LMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP-- 398 Escherichia coli
15596048 271 -THNVAEGAGVAALAAAWQERER---LKGl----kVGLILSGANVDREVFAEQLAAGD------------------- 320 Pseudomonas aeruginosa...
15892551 274 -LKVICEPSSSINMVSVVNFLKTQs-KPQK-----LLVLISGGNIDPILYNELWKEEYLSISPKSLCSDVISAKAAI 343 Rickettsia conorii
15604314 274 -LKVICEPSSSINMASVVSWLKTQt-KTQK-----LLVLISGGNIDPTLYNELWKNDYLTVPP-SISN--------- 333 Rickettsia prowazekii
17865702 340 dTPFISGESGAIGVGLLYELMNNMh-YQD------LANRLQLDASAHVLLISTEGDTSPDIYEDIVWNGRSA----- 404 Salmonella typhimurium
13541961     -----------------------------------------------------------------------------     Thermoplasma volcanium
13476574 290 dPVIVAGESGGVGLAGLIRAMAENrtDLGLDgksrVLVINTEGATDPHRYAELVGLSPADVLAGKLAAEATS----- 361 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap