Conserved Protein Domain Family
MenD

?
COG1165: MenD 
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 224087
View PSSM: COG1165
Aligned: 19 rows
Threshold Bit Score: 613.176
Threshold Setting Gi: 19551710
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568   1 MvDFTNPNTLAASVLVETLFRLGLQQAVICPGSRSSPLTVALARHG---GIDCVVSLDERSASFFALGHGKRTGQPVALV 77
gi 6166546    1 MtVNP--ITHYIGSFIDEFALSGITDAVVCPGSRSTPLAVLCAAHP---DISVHVQIDERSAGFFALGLAKAKQRPVLLI 75
gi 19551710   1 --MSSTPAQDLARAVIDSLAPH-VTDVVLCPGSRNSPLSLELLARq---DLRVHVRIDERSASFLALSLARTQARPVAVV 74
gi 15672713   1 ------MTNEYLAPFVDELFNLGVREAVFSPGSRSTALAMLFEEYk---KYDTYVNIDERSAAFFALGIAKAKKRPVVLV 71
gi 15828215   1 ----MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADhagRIRLHVRIDERTAGYLAIGLAVAAGAPVCVA 76
gi 15839953   1 ----MNPSTTQARVVIDELIRGGVRDVVLCPGSRNAPLAFALQDADrsgRIRLHVRIDERTAGYLAIGLAIGAGAPVCVA 76
gi 15926630   1 MgNHKAALTKQVFTFASELYAYGVREVVISPGSRSTPLALAFEAHP---NIKTWIHPDERSAAFFAVGLIKGSERPVAIL 77
gi 15790176   1 -mTAPNRNTLWARAIADELAAAGVHAVCVCPGSRSTPLTVAVDAHD---DLTVYSHLDERSAAFFALGRGKRTGAPTAVL 76
gi 17227808   6 PiAYKNINQLWAYIFTETLKRLGLAYAVICPGSRSTPLAVAFAQQAp--NIEAISILDERSAAFFALGIAKATNRPVAIV 83
gi 16800851   1 MtNHEQVLTDYLAAFIEELVQAGVKEAIISPGSRSTPLALMMAEHP---TLKIYVDVDERSAGFFALGLAKASKRPVVLL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568  78 CTSGTAAANFLPAIIEAHYSQVPLLVLTGDRPPRLRHCRAGQTIDQTKLYGHYPQWQTELALPEPNMD------YCHYLR 151
gi 6166546   76 CTSGTAAANFYPAVVEAHYSRVPIIVLTADRPHELREVGAPQAINQHFLFGNFVKFFTDSALPEESPQ------MLRYIR 149
gi 19551710  75 MTSGTAVANCLPAVAEAAHAHIPLIVLSADRPAHLVGTGASQTINQTGIFG-------DL-APTVGIT------ELDQVA 140
gi 15672713  72 CTSGSAAAHHFPAVLEAKMSRVPLIILTADRPAELQFVGAPQTVDQTRFFGNFVNHFENLEAPHIQKQsqt-enFWTYPR 150
gi 15828215  77 MTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAISLGLAEDAPErldslnATWRSA 156
gi 15839953  77 MTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPErtsalnATWRSA 156
gi 15926630  78 CTSGTAAANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAINQVNMFNNYVSYEFDMPIADDSKEti---nAIYYQM 154
gi 15790176  77 TTSGTATANLHPAVMEAAQARIPLVVLTADRPPELRGSGANQTVDQEQLYGSAVRYYEDLPEPEVTAR------KLRSLR 150
gi 17227808  84 CTSGTAGANFYPAVIEAQESRVPLLLLTADRPPELRDCHSGQTIDQMKLYGSYPNWQAELALPVSDMG------MLAYLR 157
gi 16800851  78 CTSGTAAANYFPAVVEANLSQIPLIVLTADRPHELRNVGAPQAMDQLHLYGSHVKDFTDMALPENSDE------MLRYAK 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568 152 QTALHSWQK-CFWPGLGVVHLNCPFDEPLVPLEHARESLQHLAEEFSKEHFYRGLTTFTTMnrGEAISLpvnfsifsfps 230
gi 6166546  150 TLASRAAGE-AQKRPMGPVHVNVPLREPLMPDLSD-EPFGR-MRTGRHVSVKTGTQSVDREslSDVAEMla--------- 217
gi 19551710 141 QIAESLAQG----ASQIPRHFNLALDVPLVAPELPELHGEAVGASWTHRWINHGEVTVDLG------------------- 197
gi 15672713 151 KVAQRAVLS-AISPLSGPVQINVPLRDLLVPELKS--ENYEKGRSKHAFKFYEGQAQVILPfdEALLS------------ 215
gi 15828215 157 TCRVLVAATgSRTANAGPVQFDIPLREPLIPDPEPHGAITPQGRPGGKPWTYIPQVTFDQ-------------------- 216
gi 15839953 157 TCRVLAAATgARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQ-------------------- 216
gi 15926630 155 QIASQYLYG----PHKGPIHFNLPFRDPLTPDLNATELLTSEMKILPHYQKSIDASALRH-----ILNK----------- 214
gi 15790176 151 TSVCRAVGH-TTGPKPGPVHLNVPFRKPLEPVSVP-GDVPPSFDDDHPLAAAGRGGDTPFVsvHDGTTEpaget-aaala 227
gi 17227808 158 QTLVHSWYR-MQAPTPGPVHLNIPFRDPLAPIPDG-TDLSYLLAKFHPEEFFAGITDTTPLphHSPLSIp---------- 225
gi 16800851 152 WHSSRAVDI-AMKTPRGPVHLNFPLREPLVPILEP-SPFTATGKKHHHVHIYYTHEVLDDSsiQKMVTEct--------- 220
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568 231 PQLDFSPLGLILVGVMPGGETPSlltdILAIARGLGYPVLCDALCSLRNYddgq-talITNYDFLIRCPRWAEQLVP--- 306
gi 6166546  218 ----eaEKGMIVCGELHSDADKEn---IIALSKALQYPILADPLSNLRNGvhdk-stvIDAYDSFLKDDELKRKLRP--- 286
gi 19551710 198 ------E-HTLVIAGDEAWEVEG-----LEDVPTIAEPTAPKPYNPVHP----------LAAEILLKEQVSAEGYVVntr 255
gi 15672713 216 ------GKTLILAGANFDKDYSEa---LLKLAEQLKAPILADPLSNLRNHnhp---lvIDSYDAFLANNDLKTQLKA--- 280
gi 15828215 217 ------PLEIDLSADTVVIAGHG----AGVHPNLTELPIVAEPTAPFGPY------------RPYPLHPLALPLLHP--- 271
gi 15839953 217 ------PLDIDLSVDTVVISGHG----AGVHPNLAALPTVAEPTAPRS--------------GDNPLHPLALPLLRP--- 269
gi 15926630 215 ------KKGLIIVGDMQHQEVDQ----ILTYSTIYDLPILADPLSHLRKFdhp---nvICTYDLLFRSG---LDLNV--- 275
gi 15790176 228 AAATTAARPLVVAGPADGGAGITpd-aAAALADATGAPIFADPLSGLRFGphvgdapvVGGYDGFLAADVP----HP--- 299
gi 17227808 226 PEWLQSQRGIIIAGVAQPQQPQEycraIARLSQTLQWPVLAEGLSPVRNYadfn-pylISTYDLILRNQQLATRLAP--- 301
gi 16800851 221 -----gKKGVFVVGPIDKKELEQp---MVDLAKKLGWPILADPLSGLRSYgamd-evvIDQYDAFLKEADILDKLTP--- 288
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568 307 -EQIIQIGELPTSKALRHWLG-TIDCPRYILNFHGENLDPLQGQTIY-LSASVAQVAEYIHNQGFIpdaeqK-NYAHSWL 382
gi 6166546  287 -DVVIRFGPMPVSKPVFLWLKdDPTIQQIVIDEDGGWRDPTQASAHM-IHCNASVFAEEIM-AGLTaatrsS-EWLEKWQ 362
gi 19551710 256 pDHVIVVGHPTLHRGVLKLMSdPG-IKLTVLSRTDIITDPGRHADQV-GSTVKVTGT--------Q-----EkQWLKICS 320
gi 15672713 281 -DAILLFGQMPVSKRLQQFVAfNNeAEFIQVDPALDYRNPSLTTTTM-VQSDVLPFASSIKKVNS------DsSYLEKWQ 352
gi 15828215 272 -KQVIMLGRPTLHRPVSALLAdPQ-VPVYALTTGPCWPDVSGNSQAA-GTRAVTTGTP-------------HpAWLQRCA 335
gi 15839953 270 -QQVIMLGRPTLHRPVSVLLAdAE-VPVFALTTGPRWPDVSGNSQAT-GTRAVTTGAP-------------RpAWLDRCA 333
gi 15926630 276 -DFVIRVGKPVISKKLNQWLKkTD--AFQILVQNNDKIDVFPIAPDIsYEISANDFFRSLMEDTTIn----RvSWLEKWQ 348
gi 15790176 300 -EFVLRFGASPTSKPLRKWLAaSD-ARQVVVDPAGGWREAEFTATDV-VAADPAATARAIAARADGt----RsAWTDAVL 372
gi 17227808 302 -DMVIQIGDMPTSKELRNWID-THQPRRWVIDPSDQNLDPLHGRTTH-LRIRVEELG--Y--QGVEedkssVsEYLQLWC 374
gi 16800851 289 -EVVIRFGSMPVSKPLKNWLEhLFGIRFYVVDPGAAWKDPIKAVTDM-IHCDERFLLDIMQ-QNMPddtkdA-SWLNRWT 364
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568 383 EKQRQSQTIIISALADAhtPLMVAQ----LAHCLPP-QTNLFVANSLPVRWLEFFWPANgDHHRIFVNRGANGIDGTLST 457
gi 6166546  363 FVNGRFREH-LQTISSEd-VSFEGNlyriLQHLVPE-NSSLFVGNSMPIRDVDTFFEKQdRPFRIYSNRGANGIDGVVSS 439
gi 19551710 321 AASELAADGVRDVLDNQefGFTGLHvaaaVADTLGT-GDTLFAAASNSIRDLSLVGMPF-DGVDTFSPRGVAGIDGSVAQ 398
gi 15672713 353 NAQEKMRQLLEKVTYEE--SPFEGRyvqeLQKHLEAlDAQLLVSNSMEIRDIDYWWKKAdAKVRILGNRGVNGIDGTEST 430
gi 15828215 336 EMNQHAISTVRSQLAAHp-LITGLHvaaaVADALRP-GDQLVLGASNPVRDMALVGLST-DGIQVRSNRGVAGIDGTVST 412
gi 15839953 334 AMNRHAIAAVREQLAAHp-LTTGLHvaaaVSHALRP-GDQLVLGASNPVRDVALAGLDT-RGIRVRSNRGVAGIDGTVST 410
gi 15926630 349 CLEKKGRKEIKCYLEQ---ATDESAfvgeLIKKTSE-KDALFISNSMPIRDVDNLLLN--KNIDVYANRGANGIDGIVST 422
gi 15790176 373 DLEARYWAAVDDFQPA---ATLEGEiaatVAAGAPD-PATVFVSNSMPIRDFDRFAAPRgADLAVLGNRGASGIDGVVSS 448
gi 17227808 375 NAETKVR-VNVDETLDKmeDLVECKaawlLSQMLPP-ETPLFIANSMPVRDVEFFWKPNnLRVRSHFNRGANGIDGTLST 452
gi 16800851 365 SYNQKAREIVLEEMANTt-TLEEGKivseLRRLLPD-KAGLFIGNSMPIRDVDTYFSQIdKKIKMLANRGANGIDGVVSS 442
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16331568 458 AMGIAHRSRGE------------TVLLTGDLSLLHDSNGFLN--QSQMRGNLTIILLNNNGGGIFQTLPIAQCED--VFE 521
gi 6166546  440 AMGVCEGTKAP------------VTLVIGDLSFYHDLNGLLA--AKKLGIPLTVILVNNDGGGIFSFLPQASEKT--HFE 503
gi 19551710 399 AIGTSLAVQSRhpdei---raprTVALLGDLSFLHDIGGLLIgpDEPRPENLTIVVSNDNGGGIFELLETGADGLrpNFE 475
gi 15672713 431 ALGIAT-TGKP------------TVLLTGDLSMLHDLNGLIVg--KTHELNLTIVLFNNDGGGIFHHLAQKGVPN---FD 492
gi 15828215 413 AIGAALAYERSpgyagstdrparTVALIGDLAFVHDSSGLLIgpTEPTPQQLKIVVSNDNGGGIFELLEQGDPRLsaVSS 492
gi 15839953 411 AIGAALAYEGAhertgspdspprTIALIGDLTFVHDSSGLLIgpTEPIPRSLTIVVSNDNGGGIFELLEQGDPRFsdVSS 490
gi 15926630 423 ALGMAV--HKR------------ITLLIGDLSFYHDMNGLLM--SKLNNIQMNIVLLNNDGGGIFSYLPQKESATd-YFE 485
gi 15790176 449 ALGAGSATADP------------VVGLVGDLAYFHDSNGLLA--LERCGVDATIVLVNNDGGSIFHMLPIEQFDP--PFT 512
gi 17227808 453 ALGISHRQQS-------------SVLITGDLALLHDTNGFLI--RNKFVGHLTIILINNNGGGIFEMLPIAKFEP--PFE 515
gi 16800851 443 ALGASV-VFQP------------MFLLIGDLSFYHDMNGLLM--AKKYKMNLTIIIVNNDGGGIFSFLPQANEPK--YFE 505
                       570       580       590       600       610       620       630
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 16331568 522 TYFATPQGVDFGQLCRTYGVEHKIITNLWDLKEQWPSNN-SSPIRVLEIIGDRHQEAQWLKSLQAQFCCADS 592
gi 6166546  504 DLFGTPTGLDFKHAAALYGGTYSCPASWDEFKTAYAPQAdKPGLHLIEIKTDRQSRVQLHRDMLNEAVREVK 575
gi 19551710 476 RAFGTPHDASIADLCAGYGIEHQVVDNLQDLIIALVDTTeVSGFTIIEASTVRDTRRAQQQALMDTVH---- 543
gi 15672713 493 YLFSTPHGLNFAGLAELTGLDYHLVSGYADFGQQFEASLhQSGIHLLEIKTDKDLSLALHQKYTTYEN---- 560
gi 15828215 493 RIFGTPHDVDVGALCRAYHVEGRQ-IEVDKLREALDEPG--VGMRVLEVKADRSSLRQLHAAITATL----- 556
gi 15839953 491 RIFGTPHDVDVGALCRAYHVESRQ-IEVDELGPTLDQPG--AGMRVLEVKADRSSLRQLHAAIKAAL----- 554
gi 15926630 486 RLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSEt---STIYELITNREDNFKQHQILYQKLSEMIH 554
gi 15790176 513 GQFKTPHGLDFAPTADTYALSFARTDTVGEFRAAYRAALgDAGTHVIEVSTDAEASHRERERLADRVTGLSV 584
gi 17227808 516 EFFGTPQDIDFAQLCTTYNVQHELIHSWVHLQQRLNPLP-NTGIRVLELRTNRKIDAQWRRDNLSNFA-ADN 585
gi 16800851 506 SLFGTSTELDFRFAAAFYDADYHEAKSVDSLEEAIDKASyHKGLDIIEVKTNRHENKANHQALWEKIATALK 577
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap