Conserved Protein Domain Family
GlnQ

?
COG1126: GlnQ 
ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224051
View PSSM: COG1126
Aligned: 130 rows
Threshold Bit Score: 87.1782
Threshold Setting Gi: 17548649
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15891516 342 GSVNIHGVSKSFGSLKVLDDISLSIPAGSVTTILGQSGSGKSTLLRSINHLERVDDGFIAIDGELVGYRQkgdtlyelke 421
gi 14601701   1 --------MVSYSGEKVLKGVDVSLSYGEKLVIMGPSGSGKSTLLKAIPRLVEPDSGSIVFRGVDVTRLSg--------- 63
gi 15618115   1 MTIRVRNLAYSVNKKKILDGVTFSLERGHITLFVGKSGSGKTMILRALAGLVQPTQGDIWIEGEAPA------------- 67
gi 15604849   1 MTVEVKDLTVAVKGKEILSNVSFSLVPRRITLFIGRSGSGKTTILRSLVGLTPISSGSISVVGDPPG------------- 67
gi 18313024   3 TIVSVRNLQVAYGSLEVVKGVDLDVSQGEKVVIMGPSGSGKSTFLRSLIWLVRPKAGSIVIDEIEVSSRT---------- 72
gi 15893264   1 -MIILEKVCKRYGKNYAIKNIDLSFTTKETTVIIGPSGSGKTTLLRILNNLEEPSSGTFLVDGKKLLLK----------- 68
gi 15901348   1 -MLELRNINKVFGDKQILSNFSLSIPEKQILAIVGPSGGGKTTLLRMLAGLETIDSGQIFYNGQPLEl------------ 67
gi 15675230   1 -MLELKNISKQFGQKTIFDGFNLTVQDGEVLSLVGPSSGGKTTLLRMLAGLESIDSGQVFYNGEDVGi------------ 67
gi 16764979   2 ALLKLKEISKEYSGKKVLDTVSLKIQSGDMKVVMGPSGCGKTTLLRCLLRLEEPDYGNIYFHGKNIYDKEf--------- 72
gi 16800917   1 -MLEIKNLSKKFDQKTILDNVNIALQDGEILSIVGPSGGGKTTLLRCISGLEKMDAGEIFIDGEKIDPm----------- 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15891516 422 rEILKRRAEVGMVFQSFNLFPHLTALENIIEAPVAVRGISKEQAEVEARDLLARVGLADKAAAYPRQLSGGQQQRVAIAR 501
gi 14601701  64 sQLRMVRRKIGYLPQSYSLFPHMTVLRNITYPLEKALGLSRRDAEERAVKYLSMLGIEDLAHRHPARLSGGQQQRAALAR 143
gi 15618115  68 -----------LVFQQPELFSHMTVLGNCTHPQIHIKGRSTEEAREKAFELLHLLDIEEVAKNYPDQLSGGQKQRVAIVR 136
gi 15604849  68 -----------FVFQQPELFPHMTVLDNCAHPQMIVKKLREREAKDKALDLLGMLELREYASSYPHQLSGGQRQRVAIAR 136
gi 18313024  73 --LMEVRKRVGFVFQHYNLFPHLKVIDNIVLPLIKVHGLSRAEAVERALEALRLVGLEEKATAYPLQLSGGQQQRVAIAR 150
gi 15893264  69 -NRRKLLLKVGMVFQNFNLFPHLTVGENLIYTPVNVLNLPKEQAISMAKELLAKFKLTQKFDSYPASLSGGQKQRTAIAR 147
gi 15901348  68 -DELQKRNLLGFVFQDFQLFPHLSVLENLTLSPVKTMGMKQEEAEKKASGLLEQLGLGGHAEAYPFSLSGGQKQRVALAR 146
gi 15675230  68 -DHLENRNLLGFVFQDFQLFPHLTVLDNLTLSPTITMGKQKADAKEKALDLLARLGLKEHAQVYPYSLSGGQKQRVALAR 146
gi 16764979  73 -TILEFRKKVGCVFQNYALYRHLNVMDNITLALCKVFGMPGQLAREKALHELQKLDMASHSAKYPSQLSGGQQQRVALAR 151
gi 16800917  69 -SRKDVENTIGVVFQEFHLFPHLSVLDNLILAPTLARKTKKEEAIKEAERLLGLLDLADKADNMPYQLSGGQKQRVAIAR 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15891516 502 ALALRPKVLLFDEPTSALDPELVNEVLDVIKELSRSGVTLIIVTHEIGFAREVSDRVVFMEQGRILETGTPDKVFNSPDH 581
gi 14601701 144 ALAMEPDILLLDEPTSALDPESRADVLEALFRVATLGKAMIVVTHEADFAVKVADRMAFMEDGIVKEE-GKPSELVE-GS 221
gi 15618115 137 SLCMDKHTLLFDEPTSALDPFATASFRHLLETLRDQELTVGLTTHDMQFVHSCLDRIYLIDQGTVAGVYDKRDGELDSGH 216
gi 15604849 137 ALALDMRTILFDEPTSALDPFSASKFLQIVLSLKEQGMTIAISTHDILFINQCLDRVYLVDKGQIIDAYDSLHDDPQANS 216
gi 18313024 151 ALAIRPKVLMLDEPTSALDPELVEEVLQVLENIAKRGTTMLIVTHEVDFALDVADRVVFFEGGKIIEQ-GPPDILYKPKT 229
gi 15893264 148 ALMMKPKILLFDEPTSALDPENIKDVIENINLLKDQM-SMVVVTHHLKFAKLIADRVIFMDQGQILANQPAEDFFNKPAS 226
gi 15901348 147 AMMIDPEIIGYDEPTSALDPELRLEVEKLILQNRELGMTQIVVTHDLQFAENIADVLLKVEPK----------------- 209
gi 15675230 147 AMMIDPQIIGYDEPTSALDPELRQTVEALIVQNREMGITQIVVTHDLVFAEAISDRIIRVNPK----------------- 209
gi 16764979 152 TMVTDPELIIFDEPTSALDPLMTREVGMLIKQLHDNGVTILCVTHDIRLARLLSDNVTFLNHGKIRAEGAFTDLALRETD 231
gi 16800917 148 ALAMNPKVLLFDEPTSALDPDLRDHVASLILSLKNVGITQIIVTHDHDFAKKVADQMMEVEPLKKEAI------------ 215
                       250
                ....*....|.
gi 15891516 582 PRTAEFLAKVL 592
gi 14601701 222 ERVRRFLESIL 232
gi 15618115 217 P-LSKYIHSAQ 226
gi 15604849 217 F-VKQYLSLQE 226
gi 18313024 230 DRFRQFLKRLH 240
gi 15893264 227 HRARLFLENIG 237
gi 15901348     -----------
gi 15675230     -----------
gi 16764979 232 PDIHCFFSEAQ 242
gi 16800917     -----------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap