Conserved Protein Domain Family
OpuBA

?
COG1125: OpuBA 
ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224050
View PSSM: COG1125
Aligned: 31 rows
Threshold Bit Score: 289.197
Threshold Setting Gi: 15611825
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17988010 143 MIEFDRITKNYN-G-RAAVDEVSFTIEPHSIAAIVGTSGSGKTTLLRMVNRLEEPTSGEIRIDGQSILDEPGHELRRRIG 220
gi 15894754   3 AIEFINVSKKFSnakyKAVDNVDLTIEEGEFITILGSSGSGKTTLLKMINRLYEPDKGSIVLFNEDIKKIDVVKLRRSIG 82
gi 15896104   1 MIELKNIYKKVN-N-RIILNNVNLTINKGELVTLIGPSGCGKTTTLKMINRLIRQTSGEILINGNKIQNEDAIKLRRNIG 78
gi 19705304   1 MIEFKNISKSYG-N-QEIIKDFNLTIECGTFLTIIGSSGSGKTTILKMINGLIKADKGEVLINDKNIQDEDLIELRRKIG 78
gi 15645438   4 IVTIENVSFNYH-N-RAVFKDFNLSIQEGDFLCVLGESGSGKSTLLGLILGLLKPSLGSVKIFNETLSN--NAFLRQKIG 79
gi 15672829   1 MIEFQNVSKAFA-N-KKILDHANFTIKDQEFFVLVGPSGSGKTTTLKMINQLVTHSEGKILINNEEISTANLRKLRLSVG 78
gi 15926399   1 MIKFKNVTKRYG-K-HVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYFKDKPISDYPVYEMRWDIG 78
gi 15901689   1 MIEYKNVALRYT-E-KDVLRDVNLQIEDGEFMVLVGPSGSGKTTMLKMINRLLEPTDGNIYMDGKRIKDYDERELRLSTG 78
gi 15675110   1 MIRFNNVSKTFG-Q-TKVLQEQTFQINDREFFVLVGPSGSGKTTLLKMINCLIEPSSGDILLNNVPQTELDLREMRLSIG 78
gi 16800528   1 MIRFDNVSKKYSdD-KTAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTIYINEKRISDYDIHELRWDIG 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17988010 221 YVIQQHGLFPHRTVGENIATVPALLGWPKQRIEARVDELLELFQLEPGAYRDRYPHELSGGQQQRVGVARALAAGPNILL 300
gi 15894754  83 YVIQQVGLFPHMTIANNIATVPKLLKWDKREIEKRIDELLHLVGLEPNEFKKRYPSQLSGGQQQRIGLARALAVDPKIML 162
gi 15896104  79 YVIQQTGLFPHLTVEENISMILKIEKVDQTKIDKKVEELLNLVGMNPEDYKYKYPSQLSGGQQQRIGIARALAMDPEIIL 158
gi 19705304  79 YVIQGNILFPHLTVFDNIAYVLNLKKYDKKEIEKIVNEKMDMLNLS-RDLKDRLPDELSGGQQQRVGIARALAASPDIIL 157
gi 15645438  80 YIAQGNSLFSHLNAMQNMTFCLNLQGINKQAAQKEAKALALKMGLDES-LMDKFPNELSGGQAQRVGIIRGIIHRPELIL 158
gi 15672829  79 YVLQQIALFPNLTVSENIALIPEMKGWDKAKIADRTNELLDLVGLNPKDYAQRQPSELSGGEQQRVGILRAIAANPKIVL 158
gi 15926399  79 YVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLDMVGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVIL 158
gi 15901689  79 YVLQAIALFPNLTVAENIALIPEMKGWSKEEITKKTEELLAKVGLPVAEYGHRLPSELSGGEQQRVGIVRAMIGQPKIFL 158
gi 15675110  79 YVLQQIALFPNLTVAENIAIIPEMKQWSAEEIRQKTEELLDKVGLPAKDYLDRYPSDLSGGEQQRIGIVRAIISHPKILL 158
gi 16800528  80 YVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRITELLDSVGLDAESYRHRKPAELSGGEQQRVGVVRALAADPGIIL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17988010 301 MDEPFGALDPVIRAKAQEDLKAIQRRFRTTILLVTHDMEEAISLGDRIAVMDEGKLLQFGPPAEILARPATEFVERLVGT 380
gi 15894754 163 LDEPFGAIDAINRMKLQDELLHIHGGLKKTFIFVTHDINEAFKLGSRVIIMDKGRICQFDTPRNIVKNPADEFVSSLISS 242
gi 15896104 159 MDEPFSALDPLTRNQLQDEIFSIHQNLKKTIVFVTHDMDEALKLADKICIMKDGKVIQYDTPDKILKNPKDDFVKTFVGE 238
gi 19705304 158 MDEPFGAVDAITRYQLQKDLKELHKKTEATIVFITHDITEALKLGTKVLVLDKGEIQQYDIPKNICSNPKNEFVKQLLKM 237
gi 15645438 159 LDEPFSALDSFNRKNLQDLIKEIHQNSHATFIMVTHDESEAQKLATKTLEIKALKQEQ---------------------- 216
gi 15672829 159 MDEPFSALDPISRRQLQIFIKDLQKKMNLTVVFVTHDLDEALYLADRVAVMNDGLIQQIAEPADIYQHPANDFVKTFFKE 238
gi 15926399 159 MDEPFSALDPISREKLQDDLIELQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGS 238
gi 15901689 159 MDEPFSALDAISRKQLQVLTKELHKEFGMTTIFVTHDTDEALKLADRIAVLQDGEIRQVANPETILKAPATDFVADLFGG 238
gi 15675110 159 MDEPFSALDPISRKQLQELMLSLHKEFDMTIVFVTHDIDEAIKLGDRVAILNEGEIVQLDRPEMIKTHPANAFVVNLFGG 238
gi 16800528 160 MDEPFSALDPISRQRLQQDISTLQKKIKKTIVFVTHDMQEALALGDRICVMQDGEIVQVATPQEIVKNPENDFVKDFLAS 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17988010 381 GERPFRLLSLTDLKTVLQPGD--------------------------ASGEPLPVTASQRD----------ALAELLWSG 424
gi 15894754 243 SRNQERLWEELG-------------------------------------------------------------------- 254
gi 15896104 239 N-RIWNQPELIKVKDIMINNViksspertsiqaleimksnhvdrlivASKDNKLLGIVTLRelkfsinenkKLKDIMKNN 317
gi 19705304 238 A-EM---------------------------------------------------------------------------- 240
gi 15645438     --------------------------------------------------------------------------------
gi 15672829 239 YRQNLSTVSVENLLLTELSVNpeaqevadntaiseiinrlsdkevlkYKGKSISSDDIICYiaggdk------------- 305
gi 15926399 239 HLEDDAPCVEENAIIRDLDIMkpidevtsmsaypivydnqpievlyqHLSESERVIVMQEDsvgqyvidrkDIFKYLSQK 318
gi 15901689 239 SVHD---------------------------------------------------------------------------- 242
gi 15675110 239 DEHA---------------------------------------------------------------------------- 242
gi 16800528 240 GHAFNTPILESSFTVNDLIEAdlfyayqasdgtmgissnervenlvrRIAEEQSVPVKDETgqfigtitnkHVMQFLARH 319
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*..
gi 17988010 425 RRALP---------------------VLDEDGRSLGRVTLEKLLHQA 450
gi 15894754     -----------------------------------------------
gi 15896104 318 ITTINendsivnvldivenqkigfipVINNDSSLVGLITKSSLLSVL 364
gi 19705304     -----------------------------------------------
gi 15645438     -----------------------------------------------
gi 15672829     -----------------------------------------------
gi 15926399 319 KEVAQhd---------------------------------------- 325
gi 15901689     -----------------------------------------------
gi 15675110     -----------------------------------------------
gi 16800528 320 LESSGelv--------------------------------------- 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap