Conserved Protein Domain Family
DppF

?
COG1124: DppF 
ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism, Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 224049
View PSSM: COG1124
Aligned: 28 rows
Threshold Bit Score: 264.127
Threshold Setting Gi: 16764611
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15828884  44 KTLVEINNMDVYYGSGKKKF-----RAINDFSIKIFEGEVLGLVGESGSGKTTVGMALAGLISHQFGQIKIAG-ETLPHK 117
gi 17988836   1 MSLISADNIVKIYQSHSLVGasarkTMLHDISISIGQGETVALLGRSGCGKSTLARLLVGLERPTSGEVRFRGvPLTKLD 80
gi 15833601   1 MTLLNVSDLSHHYAHGGFSGkhqhqAVLNNVSLTLKSGETVALLGRSGCGKSTLSRLLVGLESPSQGNISWRGeSLAKLN 80
gi 19704832   1 MKAVELINITKKYEEQE---------VLNSFSLDIEKGKCLAIMGESGSGKSTIAKIIIGLEKQNLGTVKIFGkERDIKT 71
gi 20090759   1 -MSLKAENISFGYKRGN--------LILNDVNISLGRGEVLGLIGDSGSGKSTLCKILAGYENNYQGKVSLDEkAIPSKG 71
gi 15928042   1 --MIKVTDVEKSYQSAHVFKrr-rtPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEKPDKGCVTLNDlPMHKk- 76
gi 15675791   1 -MTLEAKKLGFYHKKDQ--------WLFKEIDLEVAPGQILGIFGQSGCGKTSLSRVLAGFLQPKSGEVLVDGsHLPN-- 69
gi 16764611   1 --MLSCRDLVIRQGGKV---------LWQNLTFTISAGERVGIHAPSGTGKTTLGRVLAGWQKPTAGDVLLDGsPLPLHQ 69
gi 13541343   1 -MRLYIENISKVYKRRTSAFkwvdiPALKNISYEFDEGTIYGVIGPSGSGKTTLANISVLYDRPDSGSVYYGNkEVTRMK 79
gi 15804010   1 MTLLNVSDLSHHYAHGGFSGkhqhqAVLNNVSLTLKSGETVALLGRSGCGKSTLSRLLVGLESPSQGNISWRGeSLAKLN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15828884 118 NSKikkklneFLANKVQMIFQDPANSLNPNKNIFDIISEGLDNlsrknkgylleltlfnfdqdfvslifekyfstffkns 197
gi 17988836  81 RSGm-----kAFRREVQLIFQDSPGAVNARSSVRAIIGEPLRHl------------------------------------ 119
gi 15833601  81 RAQr-----kAFRRDIQMVFQDSISAVNPRKTVREILREPMRHl------------------------------------ 119
gi 19704832  72 -----------TFKDIEFLFQDSYNALNPSMIVEDLIYEPLQFlv----------------------------------- 105
gi 20090759  72 ------------YNPVQLVFQHPEKAVNPRWKMKDILNEGHTVp------------------------------------ 103
gi 15928042  77 ---------kVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQc------------------------------------ 111
gi 15675791  70 ----------KAFRPVQLIQQHPEQTMNPLWPMKKSLEEAYYP------------------------------------- 102
gi 16764611  70 ------------YCPVQLVPQHPELTFNPWRSAGDAVRDAWQP------------------------------------- 100
gi 13541343  80 PADl-----kSYAGIVRYVFQDPYTSLEPLRTVGWHIDTAAQS------------------------------------- 117
gi 15804010  81 RAQr-----kAFRRDIQMVFQDSISAVNPRKTVREILREPMRHl------------------------------------ 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15828884 198 eekeerfnfiseklsipdleiiyeiydkwpkkysnkeliediekakKKRQEISKQslkdlkynlIVKILKDVGLDEVVLR 277
gi 17988836 120 ----------------------------------------------TSLDETRREe-------rIQELLRLVELPPEIAD 146
gi 15833601 120 ----------------------------------------------LSLKKSEQLa-------rASEMLHAVDLDDSVLD 146
gi 19704832 106 ----------------------------------------------nTTDKSQKKe-------iVLELLEQVELSSELLT 132
gi 20090759 104 -----------------------------------------------------------------RDILDSFGIKNKWLN 118
gi 15928042 112 ----------------------------------------------DGQPKEVMEv-------qAITLLEEVGLSKAYMD 138
gi 15675791 103 ----------------------------------------------------------------SQDLRDAFGIQEKWLK 118
gi 16764611 101 ----------------------------------------------------------------DPETMRRLHVQPEWLT 116
gi 13541343 118 ------------------------------------------------IHIVQEE---------AWKIATYLGMPESRYR 140
gi 15804010 120 ----------------------------------------------LSLKKSEQLa-------rASEMLHAVDLDDSVLD 146
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15828884 278 RYPLE-FSGGQQQRIGISRAVVLRPKLLIADEPISALDVSIQAQVVNIFNDLKKQYKLTILFIAHDLRMVEYISDRIAVM 356
gi 17988836 147 RLPAQ-VSGGQLQRICIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKFAARCLVM 225
gi 15833601 147 KRPPQ-LSGGQLQRVCLARALAVEPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVM 225
gi 19704832 133 RKRDE-LSGGQLQRVCLARALSTKPQIMIFDESLSGLDPLVQDKILDLLYKIQKQYQLTYIFISHDFRLCYFLADRIILI 211
gi 20090759 119 RWPNE-LSGGELQRFALARALSPETKFLIADEITTMVDAITQAQIWNIVVDVVEKMNIGVLVVSHEKNLIKRICHDVVYL 197
gi 15928042 139 KYPNM-LSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQTQILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIF 217
gi 15675791 119 RRPSE-LSGGELQRFSIVRSLHPETKYLIADEMTTMLDSITQASVWKSLLEIVKDRNLGLIIISHEFDMLEKLCDACYMI 197
gi 16764611 117 RRPMQ-LSGGELARIAILRALDPRTRFLIADEMTAQLDPSIQKAIWVYVLEVCRSRSLGMLVISHQSALLDQVCTR---- 191
gi 13541343 141 DSIVEdLSGGQRQRLAFIIAMIADPAIIILDEPFSMLDSYNSMFLLNYLRMNKKGR--VIIYIDQNIGKVLYVADRILVM 218
gi 15804010 147 KRPPQ-LSGGQLQRVCLARALAVEPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVM 225
                       330       340       350
                ....*....|....*....|....*....|....*...
gi 15828884 357 YQGVLLEIGPAKEIMNN-SIHPYTKSLLEAVPSIESKV 393
gi 17988836 226 DEGQIVEEIKTADLDSM--RHPASRLLREAVLPPLPVR 261
gi 15833601 226 DNGQIVETQAVGEKLTF--SSDAGRVLQNAILPAFPVR 261
gi 19704832 212 DSGNITEDFKELD-KEIiPKTEIGKILLKDISKL---- 244
gi 20090759 198 DDINTV-------------------------------- 203
gi 15928042 218 KNGKIEEQIPTSALHKS--DNAYTRELIEKQLSF---- 249
gi 15675791 198 EENRTQLFKHT--------------------------- 208
gi 16764611 192 ----------------Hl---QVE-------------- 196
gi 13541343 219 DNGSIVEDQELSGILST-PSHETTKKLLKSYRKIYDGL 255
gi 15804010 226 DNGQIVETQAVGEKLTF--SSDAGRVLQNAILPAFPVR 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap