Conserved Protein Domain Family
TauB

?
COG1116: TauB 
ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 224041
View PSSM: COG1116
Aligned: 90 rows
Threshold Bit Score: 132.295
Threshold Setting Gi: 19552495
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16330081  16 TAFLAIENVSKVYPTaq--gpYTVLDGVNLEVKEGEFICIIGHSGCGKSTLLNMVSGFNQPTQGTVKLKNQLITAPGPDR 93
gi 15615243   3 KELLTFEEVSFAYSSs-----SPVIERLSFTVFENEIVAILAKSGSGKSTLFRLITRLESPDQGTIVCHAQG------KI 71
gi 15893907   1 MDKVYIKNVSVNYHSvs--aeTKALKNISFKVPDGDFVSIVGPSGCGKSTLLNIIAGLLKPSSGEVFIDNILVKGVSPKI 78
gi 15894680  17 KLVIDIKNVTKSFDE------ETVLKDVSLNVKSGEFVSILGPSGCGKSTLFNIITALTDADSGEVKVSG--------DI 82
gi 15618155   1 --MLQAHRLCYSCDN------QVILKDASFQASPGTITIILGSSGVGKTTLFRLLAGFLPLQEGELLWNGSPLn--RKDV 70
gi 15604900   1 --MLDVKSLYYSHAS------HSVFEDASASFASGQISMVLGASGSGKTTLFRIIAGLLSCSLGEILWKGQPIq--QEQI 70
gi 19703580   2 KNILDIKNLSYSFGN------NPILKDINIHVNENEMVAIVGNSGVGKSTLFNLIAGVLKKQAGKITINGSED--YIGKV 73
gi 1175227    1 --MVRIQDLSLAFNG------QTLFEHLNLTLLPNEWVSLLGSSGVGKSTLLRLLAGIETQGMVQ--G--KILFEPKVRI 68
gi 15598710  24 RLEIEFRGVAKHFPGrgksaaTLAVQGLDLAIRRGEVVSIIGPSGCGKSTLLNMGAGLYAPSEGEVRVGGERVsGPVRKV 103
gi 15902003   1 MTEIRLEHVSYAYGQ------ERILEDINLQVTSGEVVSILGPSGVGKTTLFNLIAGILEVQSGRIVLDGEEN--PKGRV 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16330081  94 MMVFQNYCLLPWKSAYDNVSLAVESVYpdKSKTEKEE--LVAHYLEMVGLTEAAQKKPGQISGGMKQRVAIARALAISPE 171
gi 15615243  72 GYMPQQDLLLPWLTILENVSLPLEIQG----KDKKEAkiIAASFFNRFGLVGTESLYPDALSGGMRQRAAFLRATLTSET 147
gi 15893907  79 GYMFQKDNLFQWLSVWDNVALGLKIKK--ELNDKTKQ--KIEELLEKYDLKDFKDHHPNELSGGMRQRVALIRTLVLDPE 154
gi 15894680  83 GYMQQKDLLLPWKTVIDNVVLPLDLKG--KNKKESRS--EAKKYIEIMGLKGYENKYPYELSGGMKQRASFLRTFLSSSE 158
gi 15618155  71 AYMQQKEALLPWRTALKNMTLSTELGI--NTSHNALSneRLEEIIHNFDLGQLLDRYPDELSGGQRQRIALAAQCLSLKP 148
gi 15604900  71 AYMQQKEALLPWRTVRKNILLLTELGS--RKQKTTIEeeCFYNVVHSFGLSSLLDRFPDELSGGQRQRVVFAMQSLSPKP 148
gi 19703580  74 AYMLQKDLLFEHKTIIDNVILPLIIAK--FDKKEALE--EGNKILKQFNLDKYANKYPQQLSGGMRQRVALIRTYMFKKN 149
gi 1175227   69 AWLPQKETLYPWLSIVDNVQLQAVLFG--RKSVKTTE--KAKMLLEKVGMAAHWHKPCSQLSGGQKQRVALARTLMQEVD 144
gi 15598710 104 SFMLQKDLLMPWRSIRRNIELGLEIDG--RAAGERRA--IAEEMLEKCHLAGFAEHYPFQLSGGMRQRAALARTLATDPQ 179
gi 15902003  73 SYMLQKDLLLEHKTVLGNIILPLLIQK--VDKAEAIS--RADKILATFQLTAVRDKYPHELSGGMRQRVALLRTYLFGHK 148
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16330081 172 VLILDEPFGALDAITKEELQEELLKIWRENNLTVLMITHDIDEALFLADRLVMMTNGPsAKIGEILDIPFD----RPRnr 247
gi 15615243 148 LLLLDEPFASLDSLTKTSMHHWLVSMWEKEKRTLLLVTHDIEEALLLSDRLFIFTNQP---LHGFTEVQVPp---DLRrk 221
gi 15893907 155 VLLLDEPFSALDYQTRLNVGSEICEIIKTECKTAIMVTHDIAEAVSISKRVIVLSKRP-ATLKKDVKITlp--dvSPIk- 230
gi 15894680 159 IMLLDEPFGALDSITKGNMQKWILQMKDVLKRTILFITHDIEEAILLSDRIYVLGSRP-GVVKKEFNIEFFmddkIKR-- 235
gi 15618155 149 ILLLDEPFSSLDVLLKEQLYQDIVALAKKENKTVLLVTHDFHDVSCLGDVLYVIKNK------TLTPVPLD----PSM-- 216
gi 15604900 149 ILLLDEPFTSLDPITKEILYQDVKRLAKEEGKTIILASHDVQDCLGVGEAFFAIQNQ------KLHSIALN----KEQ-- 216
gi 19703580 150 IFLLDEAFSALDAITKKELHKWYLDLKKEFNLTTLLITHDIEEAVFLSDRIYILGNKP-GEIIGEIKIEINpnedID--- 225
gi 1175227  145 LILLDEPFSALDAISRHQLQDLAFELLED--KSVLLVTHDPQEALRLSQRIFVLRSPEtHQTALSAVILPEg--nAPRe- 219
gi 15598710 180 VLFLDEPFSALDAQTKMILQQDLARMLCEQRKTALFITHDLVEAIAMSDRILVMSARP-GTIVEEIEVGLPlr-dNPLe- 256
gi 15902003 149 LFLLDEAFSALDEMTKMELHAWYLEIHKQLQLTTLIITHSIEEALNLSDRIYILKNRP-GQIVSEIKLDWSededKE--- 224
                       250       260       270
                ....*....|....*....|....*....|.
gi 16330081 248 --sqITDDPKYYQLRNYALDFLFHRY---AH 273
gi 15615243 222 mettEKMEQQRSSLKKDIRALLIEESlr--- 249
gi 15893907 231 ----rRECPDFSLYFNDVWKEMDINEg---- 253
gi 15894680 236 -----GFSKELLEYKSQIIGLL--------- 252
gi 15618155 217 -----RPLNNGLCFIKDLKKHLYT------- 235
gi 15604900 217 -----GIAG----LLQQMKDHLV-------- 230
gi 19703580 226 --------VQRLFYKKEILNIMNIE------ 242
gi 1175227  220 -----LHQANLWTLQQQLLQELGGEQ----- 240
gi 15598710 257 ----RRKLPEIGPLVGRLMTLLKVGEsaeLH 283
gi 15902003 225 --------VQKIAYKRQILAELGLDK----- 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap