Conserved Protein Domain Family
COG1107

?
COG1107: COG1107 
Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [Replication, recombination and repair]
Statistics
?
PSSM-Id: 224032
View PSSM: COG1107
Aligned: 9 rows
Threshold Bit Score: 764.657
Threshold Setting Gi: 15790501
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15669384   1 MIVKCPICDG--TGKKVVKYKTCPVCEGTGFI-DEFSPkqhmKRVS--KRATYDLDYG-EIPCPKCKGTGKVPVYAKCDF 74  Methanocaldococcus ...
11498935   1 --MICNACGG--KGYIEIEKE-CEICGGTGKA-KSFDP----KITAelSDEQIKMFMSg--VCGVCRGTGKVKIMDVCRE 68  Archaeoglobus fulgidus
20089795   5 MSKECPDCHG--RGYEVISTEVCPLCKGKGKS-KSVD------F-MkiSEKDIDSFLKnGAVCEKCKGKGSVEVTRPCEA 74  Methanosarcina acet...
20093597   2 PREKCPKCDG--KGKIPVGETECPRCGGTGFV-GDVDIsehfKGAAqhAVEGYDLASSrDVPCPKCQGKGVITVYEECDR 78  Methanopyrus kandle...
15678788   5 MIQSCNECKG--KGYRVKSYKICSACHGTGFR-STEDIkdhfKGVSnsARQRFDLEDShEVPCEVCRGKGEVEVRETCPT 81  Methanothermobacter...
14521821   2 AVKDCPECHG--TGKVKVGEKECPVCHGWGYVpADFNLsehlKGYRnlDNLGVDDEVD-EIPCPECHGKGVVPVYDTCPT 78  Pyrococcus abyssi
14590254   2 AVRDCPECHG--TGKIKVGEKECPVCHGWGYVpADFKLgehlKGYRnlKNLGVEEEVD-EIPCPECHGKGTVPVYDTCPT 78  Pyrococcus horikoshii
15789944     --------------------------------------------------------------------------------     Halobacterium sp. N...
15790501   2 QMATCIVCGSstDGHICATHEEDVVFDFRGDSpDQLTP-------GrfYRGTVDGFAEfG---VFVDVGGTVTGLLHRSE 71  Halobacterium sp. N...
15669384  75 CGGSGKVVKCDRCGAIIGKYPDFkd-rtLCDKCLKEEEerkk-glrNVYVFDELATFYDVEPGKFYKGVVTRIEKYGAFI 152 Methanocaldococcus ...
11498935  69 CNGTGKAGRCKICGEKVVGnh------dLCSRCRRQPH---------AYRLRNSCGIEDVRINRVYVGTVSAVTDIGVFV 133 Archaeoglobus fulgidus
20089795  75 CEGLGKIYTCKICGVRIHDPQEAee--eICSSCARSQH---------VYALDESCDLKDVEAGKLYHGIVSSIASFGVFV 143 Methanosarcina acet...
20093597  79 CGGTGYIVKCRECGKELDPDVEEd----LCEECRKKIKqirkeklpKVKVLSPACGYEDVEEGELYKGKVSRVEKYGVFI 154 Methanopyrus kandle...
15678788  82 CGGKGEVNICPSCGRMMKGRDEY------CPECQKKEK---------VYILHPACTMDDLEVGSIYRGKITRVEKYGVFV 146 Methanothermobacter...
14521821  79 CGGTGKVLVCDICGRIKGPWEPGmettwVCPECERKFK--------VVYVLDNACDYEDVEIGKYYKGIIDRVERFGVFV 150 Pyrococcus abyssi
14590254  79 CGGTGKVLVCDICGRIKGPWEPGmettwVCPECERKFK--------VVYVLDNACDYEDVEVGKYYKGIIDRVERFGVFV 150 Pyrococcus horikoshii
15789944   1 -------MTDATVGDEAAA-----------------PT---------VVRLDASCTTQEVEAGEYYHATVNGVVEYGAFV 47  Halobacterium sp. N...
15790501  72 VPGRVDSLAWDVGDDVFVQ----------VTDVHDNGN--------IDLGWSIRESMRDFRGELVHDPANDSDAALPADD 133 Halobacterium sp. N...
15669384 153 NLNEQVRGLLRPRDMISlrLENLNVGDEIIVQAIDVRPEKREIDFKYIPLT----TYDLVKYEKEVPLSQIKDISQnlve 228 Methanocaldococcus ...
11498935 134 NLNKRLRGLIHRRNLGN---NRFSEDEEILVQVSGIGLS-GEIDLKPVKMD----GYKVVEISKEVGRVEIAELEN---- 201 Archaeoglobus fulgidus
20089795 144 DLNPHVRGLMHSSNVG----VPPEVGEALIVLVKSIKAG-GKLDLIPKTLT----KYETIELEKELPLKDSSEIDTs--- 211 Methanosarcina acet...
20093597 155 ELNDRTLGLLHRRDMGDkePQDFSIGDEVVVKVTDVRPEDGEIDFTIEGIDprpdRYREEVVEKELKRVLVHDIDEs--- 231 Methanopyrus kandle...
15678788 147 SLNSHVWGLMRGl------FPDYKVGDELFVRVSQVKPYKGEVDMIPASIKg---PYEVIKLKKDLPRTRIADIDTk--- 214 Methanothermobacter...
14521821 151 RLNKHVLGLIKKKDLLG--KRQYIPGDEIIVQVLDVRPDRREIDFLEAPLT----RYREVQVKKELPITLIGDLKEe--- 221 Pyrococcus abyssi
14590254 151 RLNKHVLGLIKKKDLLG--KRQYIPGEEIIVQVLDVRPDRKEIDFLEAPLT----RYREVQVKKELPVTLIGDLREe--- 221 Pyrococcus horikoshii
15789944  48 DLSEHVSGLIHESTYSG--DPDLAVDDDVIVHLSAVRDN-GDLSFEFVDPE----EYRTEQRSHAYERTTADAVGS---- 116 Halobacterium sp. N...
15790501 134 EADSDTTDDGDTTDDSR--DAETADGGKRVSDADATTERAADASFEFSGAD-------DDDTDHETVR--VDALDD---- 198 Halobacterium sp. N...
15669384 229 MRDQVVHIRGEVVQIVQTPGPTVFTITDGTDFAWVAALEIAGLRAHPDVKVGDIVDVIGRVTIRDGRLQIERIKLQKLEG 308 Methanocaldococcus ...
11498935 202 YIGKMVEVRGLVTHIKVTGGPTIFTLLDGRASVQAAAFE-GGERAYPEVRVDDVVRVIGIVKRRENKLQIEILEMEKLLG 280 Archaeoglobus fulgidus
20089795 212 MKGRLIRIEGEVIQVKQTSGPTIFTISDEGGFIPCAAFESAGKRSYPHIDVGMIVSITGEVTPRDEQVQIEVMSMKLLTG 291 Methanosarcina acet...
20093597 232 KIGETVLIKGKIIHVQQTPGPTVFTLRDESGSIWMAAFEGPGIRAYPDIEAGDYVRVIGEVTTHDGQLQVEILDMEKLVG 311 Methanopyrus kandle...
15678788 215 SLGKTVRIVGEVIQIQQTSGPTIFTVSDETGTTWAAAFDEPGIRVYPHIQIGHIVEVIGEVNQHTGKIQIESESIERLIG 294 Methanothermobacter...
14521821 222 LAGKTVRVRGKVTQVQVTGGPTVFTLTDGTGITWAAAFEAPGVRAYPNINIGDVVEVIGKVSFHAGRIQIEIIDMHRIWG 301 Pyrococcus abyssi
14590254 222 LAGKTVKVRGKVTQVQVTGGPTVFTLTDGTGITWAAAFEAPGVRAYPNVNIGDVVEVIGKVSFHAGRIQIEIVDMHRIWG 301 Pyrococcus horikoshii
15789944 117 RIGDTVHIEGEVVQIKQTAGPTVFRVRDETSAIPCTAFEDAGVRAHPGVEVGDIVHVSGDADDREGTTQLEVDAFEVLSG 196 Halobacterium sp. N...
15790501 199 HVDDAVTVEGEITAARQTSGPTVFELTDETGAVDAAAFVEAGVRAYPEIEPGAVVQLTGTVERRRGDLQVETEAVTELTG 278 Halobacterium sp. N...
15669384 309 DEAEEIRKKIEEEIDRRAEPAKDIpFLVKSEVLERLRPKMADVAKRIRKAVLDGRPIIIRHHADTDGYCGGIALEKAILP 388 Methanocaldococcus ...
11498935 281 EEAYEVRKRVEAEIERACEPDFRG-FLIESEVLEALKEDMLKVAKELKKAIYESRPVIIRHHWDADGTCGGVALEKALTD 359 Archaeoglobus fulgidus
20089795 292 EKEAAVKFRVEKVIEEKAAPADIP-FLVESAIMERLKPRMLHVAKEIKKAIFHSTPIILRHHADADGITSAIAIERAILP 370 Methanosarcina acet...
20093597 312 TEKVEIKRAIDEALDREAEPPEDLkPMVDSEIIERLWPRMREVAKEIKRAVLEGRPVLIRHHADADGISGGVALEEAILP 391 Methanopyrus kandle...
15678788 295 NEAAEARRLIDEAIDRRAEPERKD-LLIESETLEKLRPKLVEAAKAIRRAVYDGRSILVRHHADADGICAGVAIEKAVLP 373 Methanothermobacter...
14521821 302 PEALEVKKRIEEELDKKAKPEDVG-FLVKSEVLEKLKPKIMKAAFMIRRAIFEGRPIIIRHHADTDGYTAGVALETAIVP 380 Pyrococcus abyssi
14590254 302 PEALEVKKRIEEELDKKAQPKDVG-FLVKSEVLEALKPKIMKAAFMIRRAIFEGRPIILRHHADTDGYTAGVALETAIVP 380 Pyrococcus horikoshii
15789944 197 GDSADVARRLDAALAEQADPVDVD-ALVDWPALEQLLPDLRSVARTLRRAVLEGRPIRMRHHADGDGMCASLPVQYALRQ 275 Halobacterium sp. N...
15790501 279 DRADEVRNRMDAALDDRAAPATTAlLAPDDDAVAAVHDDIVDAATAVRRAVIDARPVIVRHPTTVEGYVAGTAIERALLP 358 Halobacterium sp. N...
15669384 389 IIDKFAIDVDAIWHFFKRRPSKAPFYELEDVTKDLVFSIEDALKFGQKLPLIVLIDNGSTDEDIPAISKAKAYGIEVIVI 468 Methanocaldococcus ...
11498935 360 LVERVHSDSEAKYYLVKRRVSRAPFYELEDVVRDLDESLEDAERHGDKIPLVVLVDNGSGLEDVPAIRQFLLFGADVITI 439 Archaeoglobus fulgidus
20089795 371 LITEIGG-ADAEYYFYKRAPSKAPFYELADVTRDISFALEDYARHGQKMPLVILVDNGSTEEDVPSMRQAKVYGINMLVV 449 Methanosarcina acet...
20093597 392 ILRENNPDPEAEYHFYKRFPNKAPIYTLEDASRDLNHALEDVHRYGHQVPLLVLLDIGCTEEDVPAIEEMKAYGVDVLVI 471 Methanopyrus kandle...
15678788 374 LLRDLNPSTDAEWHYFKRAPSKAPFYELEDVVKDLSYALEDLERHGQKLPLLVLLDNGSTEEDILALMKAKIYDIEIVVV 453 Methanothermobacter...
14521821 381 LIEQVAPDPDARWHLFKRRPSRAPFYELEDVLKDIIFMMEDHQRFGDELPLIVIVDNGGTSEDIPAYKRLKAYGVKIVVI 460 Pyrococcus abyssi
14590254 381 LIEEVAPDPDARWHLFKRRPSRAPFYELEDVLKDIIFMMEDHMRFGDELPLVVIVDNGGTTEDIPAYKRLKAYGVKIVVI 460 Pyrococcus horikoshii
15789944 276 FIEDTHQDEDAARHLLKRLPSKAPYYEMEDATRDLNFALEDRARHGQKLPLLLMLDNGSTEEDTPAYKTLDNYDIPIVVV 355 Halobacterium sp. N...
15790501 359 LIRDEHAREDAEYHYVDRRPLDDAFYTIDDATGDVTSMLEAAHRHDEKHPLFVFVGTGSTTESTDALDLLDIYDADTVVV 438 Halobacterium sp. N...
15669384 469 DHHFPGEVVdgk-------veVDDYVDAHVNPYLVG-GDSNLTAGVLGTEIARMINPDVEDEIKHIPGIAVVGDHAKGEE 540 Methanocaldococcus ...
11498935 440 DHHFPDEEV-------------DSYLLYHVNPYKVG-GDSNYTSGVLCVEIARMIS---DLDMKHLAAISVVGDRAEG-E 501 Archaeoglobus fulgidus
20089795 450 DHHHPDDIV-------------DQYLIGHANPAHVG-GDFGVTAGMLCAEIARMINPGISDTIKHLPAVSAVGDRSEAPE 515 Methanosarcina acet...
20093597 472 DHHYPGEAVgenpedglkefpIDEHVKVHVNPYAAGgDGKNIPAGVLAVEIARLINPEVEDRIKHLPAVACLGDHAESPE 551 Methanopyrus kandle...
15678788 454 DHHYPGEVQdgr-------veVDEYVDTHVNPYLVG-GDSQITAGSLSVEIAKMINPEIAERILHLPGIAAVGDHANSPE 525 Methanothermobacter...
14521821 461 DHHDPREWIsed------kakVDEYVDVHVNPHHVKrGYYELTAGMLATEVARFINPEVEDKIKHLPAIAGTGDRSKAPE 534 Pyrococcus abyssi
14590254 461 DHHDPRDWIsed------kakVDEYVDVHVNPHHVKrGYYELTAGMLATEVARYVNPAVEDKIKHLPAIAGTGDRSKAPE 534 Pyrococcus horikoshii
15789944 356 DHHHPDPGA------------VDPLVDEHVNPYLHG-EDYRITTGMLCVELARMIYPGITSDLEHVPAVAGLSDRSKADA 422 Halobacterium sp. N...
15790501 439 DGGYADDAAg---------------MDVLVSPTAAG--EQPVNTGALGAQLAAVINDDVREDLAHLPAVAYWTDLPAA-- 499 Halobacterium sp. N...
15669384 541 AEQYVKIALDRLnelskkygkgrtYDREYLEKIALCMDFEAFYLRFMDGKGIVDDILATnIKEFGRHEELIDILYEQAMK 620 Methanocaldococcus ...
11498935 502 VERYIELSGK---------------SREELADIALAVEYEGFYLRFRTASQIMHEILG--FGRQDRHVKLVRMLSEYAKE 564 Archaeoglobus fulgidus
20089795 516 AGRYISLVSDRY-------------TLGELKDMALALDYEQFWLKFSSGKGLIDDILD--LGDHKVHKNLVSLLCEQANT 580 Methanosarcina acet...
20093597 552 AEQYLEIAEEAG------------FDRKWLRKIADSVDFQAFQLRHTPGRHLMNDVLGT-TGDEHRHRRLVENLYKQHKI 618 Methanopyrus kandle...
15678788 526 AEAYIELAAERG------------YEREDLERIAACIDFEAFYLRFMNGRGIIDTILG--LGSLDKHKKLVDALYREYER 591 Methanothermobacter...
14521821 535 FYQYLEYAKEKG------------LTEEDLKKIAEVIDHEAFYWKFMDGRGIIEEILLV-TGNLQRHRMLVEAIYPEVKA 601 Pyrococcus abyssi
14590254 535 FYQYLEYAKEKG------------LTEEDLKKIAEVIDHEAFYWKFMDGRGIIEDILLV-TGNLQRHRMLVDSIYSEVKE 601 Pyrococcus horikoshii
15789944 423 MTDYLDLARDAG------------YDESFLQQMSEALDYEAYMLRYDHGTQVIADILNv-DGDAQRHRELVPFLDRLASE 489 Halobacterium sp. N...
15790501 500 -YADLAADAS--------------YDSDAREALRDAVALEAFYQSYEDKRELIADLLWG---DAD--DDLADHIATQFRD 559 Halobacterium sp. N...
15669384 621 MVERQMKAVIPALKTEFLENGIILNTLDVEKYAHKFTFPAPGKTTGFAHDYIVQKYGEDkPIITLSYGPDFGVVRATDAV 700 Methanocaldococcus ...
11498935 565 AIEEQVKTAMEGVKVQILPNGIALAALDVENYAKKFTFPPPGKLTGEVHDRLKQKYER---IVTIGYGPDFAVIRSEGVE 641 Archaeoglobus fulgidus
20089795 581 MIKEQLETCLFNVKSQKLANGAIMNVIDVENYAQKFTFPPPGKTSGEMHDVLCKRNPDK-PVVTIGYGPDFAVIRSKGVL 659 Methanosarcina acet...
20093597 619 ACERQLEAALKGVK-EYETDGVKVVTLDVEKHARKFEYPGPGKTCGLVHDLKVEEEGDDaKVVTIAYGPDFAVIRATENL 697 Methanopyrus kandle...
15678788 592 KVDTQLRAAIPNLKSTRLPNGILFNVLDVEKYSHRFTFPAPGKTCGFVHDYMVQKHGEDtPIITLAYGPDFGVIRATDAV 671 Methanothermobacter...
14521821 602 KQERVLRAVLPHVKSVVLPNGIRFNTIDVELYAPKFDYPSPGKLSGIIHDHFKEKYGEDsPIITLAYGPDFAVVRASDGM 681 Pyrococcus abyssi
14590254 602 KQEKVLRAVLPHVKSVVLPNGIRFNTIDVELYAPKFDYPSPGKLSGLIHDHFKEKYGEEsPILTLAYGPDFAVVRASDGM 681 Pyrococcus horikoshii
15789944 490 AVAEQLDATRSHVEHERVASGANLYRIDVENHAHRFTYPRAGENN--RRDPRPQGRGNR------GAG-DHHRLRPGLRG 560 Halobacterium sp. N...
15790501 560 RLATELSTAEPHLS-TRHHDGVAFETLDVGAYTHQYDFPPVDLLLDALHRRADSTDVL------LGAGEDALRVRSDDAV 632 Halobacterium sp. N...
15669384 701 hekynFNLNLIVEQLMEEIPEASLDGGGHECAGSLKFVEGLRDKVIGRFIEIIKNMKP 758 Methanocaldococcus jannaschii
11498935 642 -----LDIPRIVKELREEIV-AGVDGGGHLVVGSIKFVQAKRKEVLARLAAKIGNLK- 692 Archaeoglobus fulgidus
20089795 660 -----MNIPRIVRELHEEMKGAGVSGGGHLVVGSIKFVEGMRTEVLSRLAEKIASTEV 712 Methanosarcina acetivorans C2A
20093597 698 g----INLNDIVSELEEEMPEAAVEGGGHETAGSISFVEAHRNKVLKALVEKILRDAT 751 Methanopyrus kandleri AV19
15678788 672 nekfgFNLNEIVWELAEEIPEAVIDGGGHECAGSLKYIEGLSKKVLSAFAEKVAALKG 729 Methanothermobacter thermautotrophicus st...
14521821 682 ar-ynFDLNKIVKVLEEKLPDAGVEGGGHSYAGSIKFFEGKRKEVLEAFAKEILKLKA 738 Pyrococcus abyssi
14590254 682 ak-ynFDLNKIVKILAEKLPDAGVEGGGHSYAGSIKFFEGKRKEVLEAFAKEIFKLKA 738 Pyrococcus horikoshii
15789944 561 ------------APVGRRAP--GHPHDGRRTQRRTPWGRRLRRRPPGRRLDPVRSRDA 604 Halobacterium sp. NRC-1
15790501 633 ------DVHAVVDAIDDDLTTTAGVTARGARDGRIEFLAGERDAVLDAVVDAIAAQLA 684 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap