Conserved Protein Domain Family
ACCS

?
COG1042: ACCS 
Acyl-CoA synthetase (NDP forming) [Energy production and conversion]
Statistics
?
PSSM-Id: 223972
View PSSM: COG1042
Aligned: 47 rows
Threshold Bit Score: 104.747
Threshold Setting Gi: 20094459
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17228264  21 SNPLDAIFAPQSVAIIGASEKVGSVGRTILWNLISNPfGGTVFPVNPKRHSVLGIKAYPSIAAIPETVDLAIIATPASTV 100 Nostoc sp. PCC 7120
20094459   1 ------------------MSSEIVLEHDVLTALREGG---LKTPRFTVLE------RPEEASDVPFDPPYTVKLLHSGVA 53  Methanopyrus kandle...
15793770   4 QTDPGYFFMPNHIILIGASERPYSLGERVLSNLLSTPfQGKITPVNPRHHTIAGLPAYTSLNKIPGNADLIIAVTLPDSY 83  Neisseria meningiti...
15676498   4 QTDPGYFFMPNHIILIGASEQPYSLGERVLSNLLSTPfQGKITPVNPRHHTIAGLPAYTSLNKIPGNADLIIAVTLPDSY 83  Neisseria meningiti...
15600171   3 RENLKRLLAPRHLAFIGGRGMARALKRCAEGGFAGQ-----LWLVNPQHAELEGVPCVASVADLPCGPDAAFVATNRELT 77  Pseudomonas aerugin...
14520517   1 --MDRIAKAREIIEKAKAENR-PLVEPEAKEILKLYG-----IPIPEFK------VARDEEEAVKFSREIGYPVVMKIVS 66  Pyrococcus abyssi
14520569   1 ----MKEEAVKVIEAVLEQGRTAMVEYEAKQVLKAYG-----LPVPEEK------LAKTLDEALEYAKEIGYPVVMKLMS 65  Pyrococcus abyssi
14591497   1 --MDRIARAREIIEKAKAENR-SLVEPEAKEILKLYG-----IPIPEFK------VARNEEEAVKFSREIGYPVVMKIVS 66  Pyrococcus horikoshii
14591546   1 ----MKEEAVRVIEEVLKQGRTAMVEYEAKQVLKAYG-----LPVPEEK------LAKTLDEALEYAKEIGYPVVLKLMS 65  Pyrococcus horikoshii
15966005   5 PRSLDRLIRPRSIAVFGGKEARRVIEQCDKMGFAGDI-----WPVHPREEEILGRRCYRSVADLPEAPDASFVGVNRALT 79  Sinorhizobium meliloti
17228264 101 PGIISECVDAGVQGVIIISAGFKEAGAEGIALERQILE-EARRGNIRIIGPNCLGVMSPRTGLNATFASSMAR----SGN 175 Nostoc sp. PCC 7120
20094459  54 HRARVGAIYTAVPSKERLERRVAELLERWPDAVGVIVQ---EHLDVVKGIEA---FLGIKED--DTFGTVVLLg---LGG 122 Methanopyrus kandle...
15793770  84 DTLFKTCRKKQLRHIILIQDWDSLPAAELHTAETAIRKhHGN--GLNITACTTAGIQLPSLGLNISTQDGYAA-----GH 156 Neisseria meningiti...
15676498  84 DTLFKTCRKKQLRHIILIQDWDNLSAAELHTAETAIRKhHGN--GLNITACTTAGIQLPSLGLNISTQDGYAA-----GH 156 Neisseria meningiti...
15600171  78 LDAVAALAAKGAGGAICYASGFAETGEQGLAVQRRL---LAAAGEMALLGPNCYGLLDYLHG--AALWPVAHGgrqvERG 152 Pseudomonas aerugin...
14520517  67 PQIIHKSDAGGVKINIKNDEEAREAFRTIMENARRYKPdADL--WGVIIYRMLPLGKEVIVG--MIRDPQFGPavmfGLG 142 Pyrococcus abyssi
14520569  66 PQILHKSDARVVMLNIKDEEELKKKWEEIHENAKKYNPnAEI--LGVLIAPMLKPGREVIIG--VTEDPQFGHaimfGLG 141 Pyrococcus abyssi
14591497  67 PQIIHKSDAGGVKINIKNDEEAREAFRTIMENARRYKPdADL--WGVIIYKMLPLGREVIVG--MIRDPQFGPavmfGLG 142 Pyrococcus horikoshii
14591546  66 PQILHKSDAKVVMLNIKNEEELKKKWEEIHENAKKYRPdAEI--LGVLVAPMLKPGREVIIG--VTEDPQFGHaimfGLG 141 Pyrococcus horikoshii
15966005  80 IEIIRDLATRGAGGAVCYASGFREAANELADGNDLQEAlVAAAGDMPIVGPNCYGFINMLDG--ALLWPDQHGmlrvERG 157 Sinorhizobium meliloti
17228264 176 VGFLSQSGALCTAILDWSVRE--NVGFSAFVSIG-SMLDVGWGDLIYYLGDDPQTKSIVIYMESIG-DARSFISAAREVA 251 Nostoc sp. PCC 7120
20094459 123 -KLVEELRAYIVRRPPVDGED---VERGLRRVPG--G-ERLLSEIGPNRLAEVVNAAHGVYKEEGWs--ELDVNPLLLID 193 Methanopyrus kandle...
15793770 157 TAILTGNAAVSRQIDNILNKL--RQGTSRHISLHpGISPITSADWLNRFGHSLHTKTAVLHHNPEE-DQRKLFSAIRQFT 233 Neisseria meningiti...
15676498 157 TAILTGNAAVSRQIDNILNKL--RQGTSRHISLHpGISPITSADWLNRFGHSLHTKTAVLHHNPEE-DQRKLFSAIRQFT 233 Neisseria meningiti...
15600171 153 VAVLTQSGNFAY-NLSMSDRS---LPVAYMASVG-NQAQLGIAELMDVLLDEPRVTAIGLHLEGLKnVPGFARAAYKALQ 227 Pseudomonas aerugin...
14520517 143 GIFVEILKDVSFRVAPISKEDalEMIKEIKAYPI-LAGARGEKPVNIDALADIIVKVGELALELPE-IRELDINPIFAYE 220 Pyrococcus abyssi
14520569 142 GIFVEILKDVTFRLVPITEKDarKMITEIKAYPI-LAGARGEEPADIDAIVDMLLKVSKLVDELRDyIKEMDLNPIFVYN 220 Pyrococcus abyssi
14591497 143 GIFVEILKDVSFRVAPISKDDalEMIKEIKAYPI-LAGARGEKPVNIEALADIIVKVGELALEFLK-LENSI-------- 212 Pyrococcus horikoshii
14591546 142 GIFVEILKDVTFRLVPITEKDarKMIQEIKAYPI-LAGARGEEPADIDAIVDMLLKVSKLVDDLKDyIKEMDLNPVFVYN 220 Pyrococcus horikoshii
15966005 158 ---VAILTQSSNIACNISMQk-rGLPLAYVMTAG-NQAQTGLSDIACAVLEDPRVTAVGLHIEGFDsIEALERLAARARE 232 Sinorhizobium meliloti
17228264 252 LTKPIIVIKAGRTEAAAKAAASHTGALAGSDAVLDAAFRRCGVLRVNSISDLFDMAEVLAKQPRPKGPRLTILTNAGGPG 331 Nostoc sp. PCC 7120
20094459 194 G--EAIALDGLARKAD---------------------------------------------------------------- 207 Methanopyrus kandle...
15793770 234 RHTPLILHITCRTTETDRAVLHCLARHCNFLISFNADDLEAALRAQLSDLPPLSRLDILS--DTPAEWLNAHAPKTLALH 311 Neisseria meningiti...
15676498 234 RHTPLILHITCRTTETDRAVLHCLARHCNFLVSFNADDLEAALRAQLSDLPPLSRLDILS--DTPAEWLHAHAPKNLTLH 311 Neisseria meningiti...
15600171 228 KGVPVIALKTGVSKIGAALALSHTSSLAGSDALYDSLFERLGVIRVSGPVSFVETLKAAACGHLPGGPSLVALACSGGDA 307 Pseudomonas aerugin...
14520517 221 D--EAVAVDARMLL------------------------------------------------------------------ 232 Pyrococcus abyssi
14520569 221 KGEGAVIVDARIILKQRA-------------------------------------------------------------- 238 Pyrococcus abyssi
14591497     -------------------------------------------------------------------------------- Pyrococcus horikoshii
14591546 221 KGEGAVIVDSRIILKPKD-------------------------------------------------------------- 238 Pyrococcus horikoshii
15966005 233 LRKPVVTLKVGKSEAAQLATVSHTASLAGNDRVSSALLARLGIGRVDTLPELLETLKLLHLHGPLPSADISSMSCSGGEA 312 Sinorhizobium meliloti
17228264 332 VLATDALIETGGEIAPISPETITSLDQILPTHWSHANPIDILGDADPQ--RYTQALEIAAKDTNSDGLLVILTPQAMTD- 408 Nostoc sp. PCC 7120
20094459     -------------------------------------------------------------------------------- Methanopyrus kandle...
15793770 312 FPNLPHHIRNGHLTGTPTPSICHDIASRQLARPDTQAVLTILSPSGHE--DYKKTARALIRLSEQTAKPLLVSSPFSDGi 389 Neisseria meningiti...
15676498 312 FPNLPHHIRNGHLTGTPTPSICHDIASRQLAHPDTQAVLTILSPSGHE--DYKKTARALIRLSEQTAKPLLVSSPFSDGi 389 Neisseria meningiti...
15600171 308 GLIADYAERNGLGLPSFDAGQRDELAGVLPDYANIANPLDFTTAIWGDaaALEEMLDSALRSPADAALLVLDYPGEETG- 386 Pseudomonas aerugin...
14520517     -------------------------------------------------------------------------------- Pyrococcus abyssi
14520569     -------------------------------------------------------------------------------- Pyrococcus abyssi
14591497     -------------------------------------------------------------------------------- Pyrococcus horikoshii
14591546     -------------------------------------------------------------------------------- Pyrococcus horikoshii
15966005 313 SLVADAGVRRKVNFRALREEQRQPLRESLGEMVTIANPLDYHTFVWGN--REKQTAAFTAMMHGGYALNLIVLDFPRLDr 390 Sinorhizobium meliloti
17228264 409 -PTQTAEQLKP-----YAQIAGKPILASWMGG-ADVATGEVILNRQRIPTYAYPDTAARVFSYMWQSSYNLRGIYETpvl 481 Nostoc sp. PCC 7120
20094459     -------------------------------------------------------------------------------- Methanopyrus kandle...
15793770 390 tHFDTPTQAIR-----TLSYRNTAAALKQAQLdIAPPQPCRLKTPQPQNIKKALEAADPALIAEALHLPPYRHTTHN--- 461 Neisseria meningiti...
15676498 390 tHFDTPTQAIR-----TLSYRNTAAALKQAQLdIAPPQPCRLKTPQPQNIKKALAAANPSLLAEALHLPPYRHTTHN--- 461 Neisseria meningiti...
15600171 387 -ERPQCDLLLQry-caALKRHGKVGFIASAFPeLLPARARELLHGEGVAALQGVEDGLAAWGRIARYRQRRAALLERgea 464 Pseudomonas aerugin...
14520517     -------------------------------------------------------------------------------- Pyrococcus abyssi
14520569     -------------------------------------------------------------------------------- Pyrococcus abyssi
14591497     -------------------------------------------------------------------------------- Pyrococcus horikoshii
14591546     -------------------------------------------------------------------------------- Pyrococcus horikoshii
15966005 391 cDAADWVTTCEavidsTKATGAVAGIVASLGEnMPEETAISLVSAGVVPFFGIDEALGAVETAAAIGAVWAKPAAPPllr 470 Sinorhizobium meliloti
17228264 482 pVEtTSGLpdrnlvekiistarqaKRTILTEYESKQILAAYGIPIVATcVAKTEDEAIKCAESIGypvvvKLYSHTITHK 561 Nostoc sp. PCC 7120
20094459     -------------------------------------------------------------------------------- Methanopyrus kandle...
15793770 462 -AVqFQFGshplygd--iltaccnGQTTAVLPPFTTLDSRHLARFAELdGTQTLDQFLHTLTVIP-----EYRQHILGIT 533 Neisseria meningiti...
15676498 462 -AVqFQFDshplygd--iltarcnGQTTAVLPPFTTLDSRHLARFAELdGTQTLDQFLHTLTVIP-----EYRQHILGIT 533 Neisseria meningiti...
15600171 465 aLVpICPGpl------------agDGYLLDEWQSKQALKPFGLPLPQG-VLSTPGQAREAALDLGfplvlKAVSAALPHK 531 Pseudomonas aerugin...
14520517     -------------------------------------------------------------------------------- Pyrococcus abyssi
14520569     -------------------------------------------------------------------------------- Pyrococcus abyssi
14591497     -------------------------------------------------------------------------------- Pyrococcus horikoshii
14591546     -------------------------------------------------------------------------------- Pyrococcus horikoshii
15966005 471 sRP--EGGeivtlseaeakdelaaAGVIVPGGRSAATVEEAAAAAESLgFPVALKGLGVAHKTEAga--vRLNLTNRDEV 546 Sinorhizobium meliloti
17228264 562 TDVGGVQLNlPDADAVRRAYRMIAESveq--kaGsEHFLGVTIQPMVKtd-gYELIIGSSLDPQFGPVLLFGAGGQLVEV 638 Nostoc sp. PCC 7120
20094459     -------------------------------------------------------------------------------- Methanopyrus kandle...
15793770 534 LNLNGGQYSsDFILKTPETHDTPKRK-------N-TGKAAQTLEHAAAkmqsAAAYLKHKNPTAAEFLRHTSEAAAELLG 605 Neisseria meningiti...
15676498 534 LNLNGGQYSsDFLLKTPETHDTPKRK-------N-TGKAAQTLEHAAAkmqsAAAYLKHKNPTAAEFLRHTSEAAAELLG 605 Neisseria meningiti...
15600171 532 TEAGGVALGlRNEAALEAALFDMRESlar--haPqLVFERVLLERMAGap-lAELIVGVKREEGFGLALVIGAGGILVEL 608 Pseudomonas aerugin...
14520517     -------------------------------------------------------------------------------- Pyrococcus abyssi
14520569     -------------------------------------------------------------------------------- Pyrococcus abyssi
14591497     -------------------------------------------------------------------------------- Pyrococcus horikoshii
14591546     -------------------------------------------------------------------------------- Pyrococcus horikoshii
15966005 547 IEAARGMASvASGYLVEKMIAKPVAElivgaarDaVAGPVLTIGAGGIlvelLEDSAILTLPVTEESIRDAIAGLKISRL 626 Sinorhizobium meliloti
17228264 639 FQDGAIALPPLNSTL 653 Nostoc sp. PCC 7120
20094459     --------------- Methanopyrus kandleri AV19
15793770 606 SKTETGAAVPNVLAP 620 Neisseria meningitidis Z2491
15676498 606 SKTETGAAVPNVLAP 620 Neisseria meningitidis MC58
15600171 609 LRDSRSLLLPTTDAA 623 Pseudomonas aeruginosa PA01
14520517     --------------- Pyrococcus abyssi
14520569     --------------- Pyrococcus abyssi
14591497     --------------- Pyrococcus horikoshii
14591546     --------------- Pyrococcus horikoshii
15966005 627 LDGYRGNPKGDIAAL 641 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap