Conserved Protein Domain Family
FAA1

?
COG1022: FAA1 
Long-chain acyl-CoA synthetase (AMP-forming) [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 223953
View PSSM: COG1022
Aligned: 36 rows
Threshold Bit Score: 448.305
Threshold Setting Gi: 15601858
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161   59 LPQIIQTALDGYAERPALGQRVAEFTKDPKT----G-RTSMEL-LPSFETITYRQLGDRVGALARAWRHD-L-------L 124
gi 19074698   26 CAPDGSKTIL-----ELLGARCASMGSDPFL----GtIVGSEV-KYRSAEDIWREAEGLAALFARLLAQE---------- 85
gi 19074700  108 CAPDGSKTIL-----ELLGARCASMGSDPFL----GtIVGSEV-KYRSAEDIWREAEGLAALFARLLAQE---------- 167
gi 15596814    1 ----------MVTANRLPLEVFFEREKRHPQ----RrYLVQPIgGGRVEELSWGEVGDQARRAAAWLRTLdLp------A 60
gi 19112518   50 FGNKKAMGYRNLVKEHVETKMVTKVVDGEKKe--vPkSWSYFE-LSDYNYLSFNDIYDKALRYAGALRKLgL-------- 118
gi 19112977   54 HGEKQAMGSRKLIKENREEREIIRKVDNEEVv--eKkLWTTYE-LGPYEYISFNKVYEIALALGSGLVASgIt------S 124
gi 729924     81 SENLVSCVDKNLRTAYDHFMFSARRWPQRDClgsrPiDKATGTwEETFRFESYSTVSKRCHNIGSGILSLvNtkrkrplE 160
gi 729925     53 GGKRDGMAWRDVIEIHETKKTIVRKVDGKDKs--iEkTWLYYE-MSPYKMMTYQELIWVMHDMGRGLAKIgIk------P 123
gi 1346423    53 GGKRDGMAWRDIIDIHETKKTIVKRVDGKDKp--iEkTWLYYE-LTPYITMTYEEMICVMHDIGRGLIKIgVk------P 123
gi 266448     53 NKNSNAMGWRDVKEIHEESKSVMKKVDGKETs--vEkKWMYYE-LSHYHYNSFDQLTDIMHEIGRGLVKIgLk------P 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  125 HaGYRVCVLGFNSVDYAIIDMALGVIGAVAVPLQTSAAITQLQSIVTETEPSMIATSVNQLPDTVELILSGQAPaklvVF 204
gi 19074698   86 ---DKVGIYSVNRYEWVVSEMASYMSGCINVPLYSTFSPADVRQILAETEMKVCVASADKAQLLLETVLEDSKAg----- 157
gi 19074700  168 ---DKVGIYSVNRYEWVVSEMASYMSGCINVPLYSTFSPADVRQILAETEMKVCVASADKAQLLLETVLEDSKAg----- 239
gi 15596814   61 G--SRIAIISKNCAHWIVTDLAIWMAGHVSVPLYPNLTAESARQVLEHSESAVVFVGKLDDWPAMAPGVP---------- 128
gi 19112518  119 NkGDKFELYAPTSAFWLLTAEACLSQSMTIVTAYDTLGEEGLLHSLRESGVRGMYTEGHLLKTLVNPLKEIESLeviiYR 198
gi 19112977  125 --ETTMLFFAATSAKWFTTAQGCSSQAIPIVTAYETLGEDGIYTSLDECKSRAIFTDPNLIPKLLGPLKQST------WV 196
gi 729924    161 AnDFVVAILSHNNPEWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYHVLKMVPDMKFVnt-lVC 239
gi 729925    124 NgEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTDNQLLAKMIVPLQSAKDIkfliHN 203
gi 1346423   124 NgENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDSVAIFTDNQLLSKLAVPLKTAKNVkfviHN 203
gi 266448    124 NdDDKLHLYAATSHKWMKMFLGAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIFTDNSLLPSLIKPVQAAQDVkyiiHF 203
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  205 DYHPEVD------EQHDAVATARARLADSSVVVESLTeVLGRGKTLPATpipvADDSADPLALLIYTSGSTGAPKGAMYL 278
gi 19074698  158 -LSCIVL------MDRDAGVAERLRNAG--VLVYYFGdVVSSGDKAGRK----RYPKGDDLATICYTSGTSGSPKGVMLT 224
gi 19074700  240 -LSCIVL------MDRDAGVAERLRNAG--VLVYYFGdVVSSGDKAGRK----RYPKGDDLATICYTSGTSGSPKGVMLT 306
gi 15596814  129 ----------------EGIPTVAMPLHPEGRFDRQWSdLQACAPLEGDT-----PTAAEQLATLIYTSGTTGVPKGVMHN 187
gi 19112518  199 NDAKEED--------------IKTIQEIRPNLKLIKFaDFEKMSPpv----epDPPSPEEICCIMYTSGSTGLPKGVILS 260
gi 19112977  197 KLIVCSS--------TPSEDLVELVKSTAPDVEIITYdNLLSLGKEKPQp--pHPPKADDICCYMYTSGSTGKPKGVVLL 266
gi 729924    240 MDELTHD------ELRMLNESLLPVKCNSLNEKITFFsLEQVEQVGCFNkipaIPPTPDSLYTISFTSGTTGLPKGVEMS 313
gi 729925    204 EPIDPNDrrqngkLYKAAKDAINKIREVRPDIKIYSFeEVVKIGKKSKDevklHPPEPKDLACIMYTSGSISAPKGVVLT 283
gi 1346423   204 EPIDPSDkrqngkLYKAAKDAVDKIKEVRPDIKIYSFdEIIEIGKKAKDevelHFPKPEDPACIMYTSGSTGTPKGVVLT 283
gi 266448    204 DSISSEDrrqsgkIYQSAHDAINRIKEVRPDIKTFSFdDILKLGKESCNeidvHPPGKDDLCCIMYTSGSTGEPKGVVLK 283
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  279 Q----SNVGKMWRRSDgnwfgPT-AASITLNFMPMSHVMGRG-Il----yGTLGNGGTAYFAARSDLSTLLEDLKLVRPT 348
gi 19074698  225 HrnfvSCVAGISRGSRagemvEIgRDDVYLSYLPLAHVMER--Vc----mNISMASGCRIVFFRGNLKEIKEDYLVVRPT 298
gi 19074700  307 HrnfvSCVAGISRGSRagemvEIgRDDVYLSYLPLAHVMER--Vc----mNISMASGCRIVFFRGNLKEIKEDYLVVRPT 380
gi 15596814  188 FssfaFAASRGVELFG------TrEDDRMLSYLPLCHVAERMfV------EMGSLYGGTTVFFAESLDTFVEDMKRARPT 255
gi 19112518  261 HknmvAIVTAIVKHVP-----EVtSKDYLLAYLPLAHILEFAfEniclawGGTIGYANVRTLVDTNCRNCKGDINTFRPT 335
gi 19112977  267 HrniiAALGGINRILSq----HInVKDYVLAYLPLAHIFEFIfEmcclywGGVLGYASPRTLTDASVVNCKGDLTEFRPT 342
gi 729924    314 HrniaSGIAFAFSTFRip-pdKRnQQLYDMCFLPLAHIFERMvIa-----YDLAIGFGIGFLHKPDPTVLVEDLKILKPY 387
gi 729925    284 HynivSGIAGVGHNVFg----WIgSTDRVLSFLPLAHIFELVfEfeafywNGILGYGSVKTLTNTSTRNCKGDLVEFKPT 359
gi 1346423   284 HynivAGIGGVGHNVIg----WIgPTDRIIAFLPLAHIFELTfEfeafywNGILGYANVKTLTPTSTRNCQGDLMEFKPT 359
gi 266448    284 HsnvvAGVGGASLNVLk----FVgNTDRVICFLPLAHIFELVfEllsfywGACIGYATVKTLTSSSVRNCQGDLQEFKPT 359
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  349 ELNFVPRIWETLYDESKRAVDRRLANSGSADRAAIKAEVM----DEQR------------------QSLLG-GRYIAAMT 405
gi 19074698  299 FIIAVPRVLNLFKEKIEEKVQQKNFAARCAFRGALWYKMWrvskGELRsrfvdw------lvfdriAKEFG-GRINRILC 371
gi 19074700  381 FIIAVPRVLNLFKEKIEEKVQQKNFAARCAFRGALWYKMWrvskGELRsrfvdw------lvfdriAKEFG-GRINRILC 453
gi 15596814  256 LLFGVPRIWTKFQMGVYSKMPAQKLDR--LLKLPILGrivg----------------------rkvLAGLGlDAVRYALC 311
gi 19112518  336 IMVGVPAVWEMVRKGIMSKLNAASAVKRSVFWTAYYTKAKlmrhNLPGscvldt------avfnkiRSMGTgGRLRYTLS 409
gi 19112977  343 VLIGVPAVYELIKKGILAKVSSMPAHRQKVFSGSLSLKQYlierNLPGsaalda------ivfnkvKAATG-GRLRYCIS 415
gi 729924    388 AVALVPRILTRFEAGIKNALDKSTVQRN-VANTILDSKSArftaRGGPdksimnflvyhrvlidkiRDSLGlSNNSFIIT 466
gi 729925    360 IMIGVAAVWETVRKAILEKISDLTPVLQKIFWSAY----SmkekSVPCtgflsr------mvfkkvR-QATgGHLKYIMN 428
gi 1346423   360 VMVGVAAVWETVRKGILAKINELPGWSQTLFWTVY----AlkerNIPCsgllsg------lifkriR-EATgGNLRFILN 428
gi 266448    360 IMVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNmqrlHIPGggalgn------lvfkkiR-TATgGQLRYLLN 432
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  406 GSAPTSPELKHGVESLLeMHLLEGYGSTE---AGMVL-FDGEVQR------P-PVIDYKLVDvpdlgyf---stdqpypR 471
gi 19074698  372 GSAPLRREVLVYMQAVLsCRIFQGYGQTEnvgAGIVQpLDSRVYDnv--giPfPANEVNLGEipeelgseymrrypgcrV 449
gi 19074700  454 GSAPLRREVLVYMQAVLsCRIFQGYGQTEnvgAGIVQpLDSRVYDnv--giPfPANEVNLGEipeelgseymrrypgcrV 531
gi 15596814  312 GAAPVPEALLLWYRRLG-LDVLEVYGMTEnsgYSHVCrPGRQKTGwi--gqNsPGVEVRISD-----------------E 371
gi 19112518  410 GGSALSPDTKRFLSIVL-CPMLIGYGLTEisaAAMVQnPACFNLDdsa-gsLlPCTEMKLVDceegnyn----shghppR 483
gi 19112977  416 GGAALAASTQAFLSSCI-CPVLPGYGLTEtcaGSFVLsPEQWHLYantvgfPiPSIEFKLVDipdlgyy----tdssppR 490
gi 729924    467 GSAPISKDTLLFLRSALdIGIRQGYGLTEtfaGVCLSePFEKDVGsc--gaIgISAECRLKSvpemgy-----hadkdlK 539
gi 729925    429 GGSAISIDAQKFFSIVL-CPMIIGYGLTEtvaNACVLePDHFEYGiv--gdLvGSVTAKLVDvkdlgy------yaknnQ 499
gi 1346423   429 GGSAISIDAQKFLSNLL-CPMLIGYGLTEgvaNACVLePEHFDYGia--gdLvGTITAKLVDvedlgy------faknnQ 499
gi 266448    433 GGSPISRDAQEFITNLI-CPMLIGYGLTEtcaSTTILdPANFELGva--gdLtGCVTVKLVDveelgy------faknnQ 503
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  472 GELLLKTQNMFPGYYKRPEVTATVFDSDGYYQTGDI-VAEVGpDRLVYVDRRNNVLKLAQGQFVTVAKLEA-AFSNSPLV 549
gi 19074698  450 GEILLRGDNVTQGYYKRPKETGQLFTKDGWLRTGDIgMFDSSaGVFSVIGRVKDGFKTSQGEYIDPEKLEV-LYADGDVV 528
gi 19074700  532 GEILLRGDNVTQGYYKRPKETGQLFTKDGWLRTGDIgMFDSSaGVFSVIGRVKDGFKTSQGEYIDPEKLEV-LYADGDVV 610
gi 15596814  372 GEVQVRSGATMVGYYKEPEKTAEVLTADGFLRTGDKgEQDAD-GNLRLTGRMKEIFKTSKGKYVAPAPIEN-RLAVHDRI 449
gi 19112518  484 GEIWLRGPSLTRGYLNRDKENKESFTPDGWFRTGDVgELTPE-GLLRIIDRKKNLVKTQNGEYIALEKLES-RYRTSSLV 561
gi 19112977  491 GEVWIRGPAVCNGYLNRPEDNKAAFTEDGWFKTGDVgEIAKG-NTLRLIDRKKNIVKSLNGEYIALEKIEA-QFFTSPLV 568
gi 729924    540 GELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVaFIDGK-GRISVIDRVKNFFKLAHGEYIAPEKIENiYLSSCPYI 618
gi 729925    500 GELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIvEWTPK-GQLKIIDRRKNLVKTLNGEYIALEKLES-VYRSNSYV 577
gi 1346423   500 GELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIaEWTPK-GQVKIIDRKKNLVKTLNGEYIALEKLES-IYRSNPYV 577
gi 266448    504 GEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIgEWEAN-GHLKIIDRKKNLVKTMNGEYIALEKLES-VYRSNEYV 581
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15827161  550 RQIYIYGnSAHPYLLAVVVPTEDALAt----NDIEVLKPLII----DSLQKVAKEADLQSYEVPRDLIVETTP--FSLEN 619
gi 19074698  529 QDVCIPRrSDSDRIVAIVVCPETKKS------DAEILAHVR-----ETGEKLFKQRRITRLEIPWRVVVLRRG--FESFE 595
gi 19074700  611 QDVCIPRrSDSDRIVAIVVCPETKKS------DAEILAHVR-----ETGEKLFKQRRITRLEIPWRVVVLRRG--FESFE 677
gi 15596814  450 EQVCVVG---EGLSAPLGLCVLSEVG------RREALN----------G-TRGALESSLRAHLEQVNGALDKH-----ER 504
gi 19112518  562 SNICVYAdQTKVKPLAIIVPNEPVVRkl-atEQAGLSPDA-------SWEEVCHNKKVRQLVYDDLIRIGRSHhfANIEL 633
gi 19112977  569 SNVCAYAdVNHAKPVVIVNPDENGLRtyltkNSGSSFNGNPN----DTLTNLCKDSGVQHLILKELINIGKQQrlASIEI 644
gi 729924    619 TQIFVFGdPLKTFLVGIVGVDVDAAQp----ILAAKHPEVKTwtkeVLVENLNRNKKLRKEFLNKINKCTDGL--QGFEK 692
gi 729925    578 KNICVYAdESRVKPVGIVVPNPGPLSkf-avKLRIMKKGE-------DIENYIHDKALRNAVFKEMIATAKSQglVGIEL 649
gi 1346423   578 QNICVYAdENKVKPVGIVVPNLGHLSkl-aiELGIMVPGE-------DVESYIHEKKLQDAVCKDMLSTAKSQglNGIEL 649
gi 266448    582 ANICVYAdQSKTKPVGIIVPNHAPLTkl-akKLGIMEQKDSS----INIENYLEDAKLIKAVYSDLLKTGKDQglVGIEL 656
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*..
gi 15827161  620 G--LLTGIRKLAWPKLKQHYGARLEQLYADLVEGQANALHVLKQSVA 664
gi 19074698  596 GadLLTPTAKKRRPLIERYFSQEIDSLLGIK---------------- 626
gi 19074700  678 GadLLTPTAKKRRPLIERYFSQEIDSLLGIK---------------- 708
gi 15596814  505 LvgLVLVQETWAVDNGFLTPTLKIKRNMVEGAYGSRFHEWVERREAV 551
gi 19112518  634 IqnVVLVPIEFTPENGLVTAAQKLQRRKILDRFKKEIDAAYAE---- 676
gi 19112977  645 PegVVLSDFEWTAENNFLTASRKVKRQVIVAHYSDEIQKAYSKKH-- 689
gi 729924    693 LhnIKVGLEPLTLEDDVVTPTFKIKRAKASKFFKDTLDQLYAEGSLV 739
gi 729925    650 LcgIVFFDEEWTPENGFVTSAQKLKRREILAAVKSEVERVYKENS-- 694
gi 1346423   650 LcgIVFFEEEWTPENGLVTSAQKLKRRDILAAVKPDVERVYKENT-- 694
gi 266448    657 LagIVFFDGEWTPQNGFVTSAQKLKRKDILNAVKDKVDAVYSSS--- 700
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap