1E9Z,1E9Y


Conserved Protein Domain Family
UreC

?
COG0804: UreC 
Click on image for an interactive view with Cn3D
Urease alpha subunit [Amino acid transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 223875
View PSSM: COG0804
Aligned: 25 rows
Threshold Bit Score: 1062.72
Threshold Setting Gi: 2507520
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B        1 MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTI----YGEELKFGGGKTLREGMSQSNNPs-------kEELDLI 69
1E9Y_B        1 MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTI----YGEELKFGGGKTLREGMSQSNNPs-------kEELDLI 69
gi 15612817   1 -MKLTRAQHASLYGPTVGDKVRLADTDLLLEIEKDYTV----YGDECKFGGGKVLRDGMGQSAVYtr-----deGVLDLI 70
gi 2501621    1 -MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTV----YGEEMIFGGGKTIRDGMGQNGRItg-----kdGALDLV 70
gi 19551336   2 SFEISRKQYTDLYGPTVGDSVRLADTELFLCVEKDYAA----IGEEVAFGGGKVIRDGMGQNGTLvr-----dvDIPDTV 72
gi 2507520    1 MARLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCGgpglAGDEAVFGGGKVLRESMG-QGRAsr-----adGAPDTV 74
gi 2507520    1 MARLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCGgpglAGDEAVFGGGKVLRESMG-QGRAsr-----adGAPDTV 74
gi 15927870   2 SFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAV----YGEEATFGGGKSIRDGMAQNPRVtrd----dvNVADLV 73
gi 2501620  268 PFVVPRKLYAVMYGPTTNDKIRLGDTNLIVRVEKDFTE----YGNESVFGGGKVIRDGTGQSSSKsm------dECLDTV 337
gi 12643778   1 MFKISRKNYSDLYGITTGDSVRLGDTNLWVKVEKDLTT----YGEESVFGGGKTLREGMGMNSTMklddklgnaEVMDLV 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B       70 ITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKnnLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAF 149
1E9Y_B       70 ITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKnnLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAF 149
gi 15612817  71 ITNATIIDYTGIVKADIGIKDGHIVGIGKGGNPDIMDGVEshMIVGASTEAIAGEGLIVTAGGIDAHIHFISPQQIDVAI 150
gi 2501621   71 ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDphMVIGAGTEVISGEGKILTAGGVDTHIHFICPQQMEVAL 150
gi 19551336  73 ITNVIVLDYTGVYKADVALRDGKIFRIGKAGNPNVMENVD--IVIGVATDIIAGEGKILTAGGIDTHVHFLGTDQVNTAL 150
gi 2507520   75 ITGAVIIDyWGIIKADIGIRDGRIVGIGKAGNPDIMTGVHrdLVVGPSTEIISGNRRIVTAGTVDCHVHLICPQIIVEAL 154
gi 2507520   75 ITGAVIIDyWGIIKADIGIRDGRIVGIGKAGNPDIMTGVHrdLVVGPSTEIISGNRRIVTAGTVDCHVHLICPQIIVEAL 154
gi 15927870  74 ISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVD--IIIGSTTDIIAAEGKIVTAGGIDTHVHFINPEQAEVAL 151
gi 2501620  338 ITNAVIIDHTGIYKADIGIKNGYIVGIGKAGNPDTMDNIGenMVIGSSTDVISAENKIVTYGGMDSHVHFICPQQIEEAL 417
gi 12643778  77 ITNALIVDYTGIYKADIGIKNGKIAAIGKSGNPHLTDNVD--MIVGISTEISAGEGKIYTAGGLDTHVHWLEPEIVPVAL 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B      150 ASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFXIHEDWGTTPS 229
1E9Y_B      150 ASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFXIHEDWGTTPS 229
gi 15612817 151 ASGITTMLGGGTGPATGTKATTCTPGKWNIERMLEAADAFPVNLGFLGKGNASTPAPLREQIEAGAIGLKLHEDWGTTPA 230
gi 2501621  151 SSGVTTLLGGGTGPATGSKATTCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPS 230
gi 19551336 151 ASGITTMIGGGTGPSQASMATTVTPGQWNTYNMLSAFEGMPMNFGILGKGHGSSKSPLAEQVRAGAIGLKIHEDWGATPS 230
gi 2507520  155 AAGTTTIIGGGTGPAEGTKATTVTPGEWHLARMLESLDGWPVNFALLGKGNTVNPDALWEQLRGGASGFKLHEDWGSTPA 234
gi 2507520  155 AAGTTTIIGGGTGPAEGTKATTVTPGEWHLARMLESLDGWPVNFALLGKGNTVNPDALWEQLRGGASGFKLHEDWGSTPA 234
gi 15927870 152 ESGITTHIGGGTGASEGSKATTVTPGPWHIHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPS 231
gi 2501620  418 ASGITTMYGGGTGPSTGTNATTCTPNKDLIRSMLRSTDSYPMNIGLTGKGNDSGSSSLKEQIEAGCSGLKLHEDWGSTPA 497
gi 12643778 155 DGGITTVIAGGTGMNDGTKATTVSPGKFWVKSALQAADGLSINAGFLAKGQGMEDP-IFEQIAAGACGLKIHEDWGATGN 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B      230 AINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVN 309
1E9Y_B      230 AINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVN 309
gi 15612817 231 AIRTCLSVADRMDVQVAIHTDTLNEAGFVEDTIKAIGDRVIHTYHTEGAGGGHAPDIMKVAGLPNVLPSSTNPTRPFTVN 310
gi 2501621  231 AIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSSTTPTIPYTVN 310
gi 19551336 231 SINTALEVADDMDIQVALHSDTLNEAGFVEDTIEAIAGRVIHTFHTEGAGGGHAPDLIRVAALPNVLPASTNPTLPYTRN 310
gi 2507520  235 AIDTCLAVADVAGVQVALHSDTLNETGFVEDTIGAIAGRSIHAYHTEGAGGGHAPDIITVAAQPNVLPSSTNPTRPHTVN 314
gi 2507520  235 AIDTCLAVADVAGVQVALHSDTLNETGFVEDTIGAIAGRSIHAYHTEGAGGGHAPDIITVAAQPNVLPSSTNPTRPHTVN 314
gi 15927870 232 ALSHALDVADEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPSSTNPTLPYTHN 311
gi 2501620  498 AIDSCLSVCDEYDVQCLIHTDTLNESSFVEGTFKAFKNRTIHTYHVEGAGGGHAPDIISLVQNPNILPSSTNPTRPFTTN 577
gi 12643778 234 AIDLALTVADKTDVAVAIHTDTLNEAGFVEHTIAAMKGRTIHAYHTEGAGGGHAPDILETVKYAHILPASTNPTIPYTVN 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B      310 TEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGR 389
1E9Y_B      310 TEAEHMDMLMVCHHKDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGR 389
gi 15612817 311 TIDEHLDMLMVCHHLDPNVPEDVAFADSRIRPETIAAEDILQDLGVISMISSDSQAMGRVGEVIIRTWQTADKMKKQRGA 390
gi 2501621  311 TMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGA 390
gi 19551336 311 TVEEHLDMVMVAHHLNPDIPEDVAFADSRIRAETIAAEDVLHDMGIFSITSSDSQAMGRVGETITRTWQVADHMKRTRGS 390
gi 2507520  315 TLDEHLDMLMVCHHLNPRIPEDLAFAESRIRPSTIAAEDVLHDMGAISMIGSDSQAMGRVGEVVLRTWQTAHVMKARRGA 394
gi 2507520  315 TLDEHLDMLMVCHHLNPRIPEDLAFAESRIRPSTIAAEDVLHDMGAISMIGSDSQAMGRVGEVVLRTWQTAHVMKARRGA 394
gi 15927870 312 TVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSMISSDSQAMGRVGEVITRTWQVAHRMKEQRGP 391
gi 2501620  578 TLDEELDMLMVCHHLSRNVPEDVAFAESRIRAETIAAEDILQDLGAISMISSDSQAMGRCGEVISRTWKTAHKNKLQRGA 657
gi 12643778 314 TIAEHLDMLMVCHHLNPKVPEDVAFADSRIRSQTIAAEDLLHDMGAISIMSSDTLAMGRIGEVATRTWQMAHKMKAQFGS 393
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B      390 LKEEKGD---NDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANAS 466
1E9Y_B      390 LKEEKGD---NDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANAS 466
gi 15612817 391 LAEDQGKg--NDNVRIKRYVSKYTINPAITHGIDDYVGSVEVGKLADLVLWDPRFFGVKPELILKGGLIAYSQMGDPNAS 468
gi 2501621  391 LAGENG----NDNVRAKRYIAKYTINPAITHGLSHEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNAS 466
gi 19551336 391 LTGDAPY---NDNNRLRRFIAKYTINPAIAHGVDYVVGSVEEGKFADLVLWDPKFFGVKPDLVIKGGLMVNSLMGDSNGS 467
gi 2507520  395 LEGDPSGsqaADNNRVRRYIAKYTICPAIAHGMDHLIGSVEVGKLADLVLWEPAFFGVRPHVVLKGGAIAWAAMGDANAS 474
gi 2507520  395 LEGDPSGsqaADNNRVRRYIAKYTICPAIAHGMDHLIGSVEVGKLADLVLWEPAFFGVRPHVVLKGGAIAWAAMGDANAS 474
gi 15927870 392 LDGDFEH---NDNNRIKRYIAKYTINPAITHGISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGS 468
gi 2501620  658 LPEDEGSg--VDNFRVKRYVSKYTINPAITHGISHIVGSVEIGKFADLVLWDFADFGARPSMVLKGGMIALASMGDPNGS 735
gi 12643778 394 LKGDSEF---SDNNRVKRYISKYTINPAIAHGVDSYIGSLEVGKLADIVAWEPKFFGAKPYYVVKMGVIARCVAGDPNAS 470
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1E9Z_B      467 IPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVF 546
1E9Y_B      467 IPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELGLERQVLPVKNCRNVTKKDMQFNNTTAHIEVNPETYHVF 546
gi 15612817 469 IPTPQPVFSRPMFGSFGRARGTTSITFLSKAAMDLGVHEALGLQKKIAHVKNCRSISKRSMKYNDATPNIEIDPETYEVK 548
gi 2501621  467 IPTPEPVFMRQMYASYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVF 546
gi 19551336 468 IPTPQPRTLRNTWGAFGQAVSRSSITFLSQDAIDANVPDLLNLRKQIRGVRGVRNLTKRDMKLNAEMPDIRVDPETYQVF 547
gi 2507520  475 IPTPQPVLPRPMFGAAAATAAATSVHFVAPQSIDARLADRLAVNRGLAPVADVRAVGKTDLPLNDALPSIEVDPDTFTVR 554
gi 2507520  475 IPTPQPVLPRPMFGAAAATAAATSVHFVAPQSIDARLADRLAVNRGLAPVADVRAVGKTDLPLNDALPSIEVDPDTFTVR 554
gi 15927870 469 IPTSEPMKYRKMYGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDVDPQTYEVY 548
gi 2501620  736 IPTVSPLMSWQMFGAHD---PERSIAFVSKASITSGVIESYGLHKRVEAVKSTRNIGKKDMVYNSYMPKMTVDPEAYTVT 812
gi 12643778 471 IPTCEPVIMRDQFGTYGRLLTNTSVSFVSKIGLENGIKEEYKLEKELLPVKNCRSVNKKSMKWNSATPNLEVDPQTFDAA 550
                       570       580       590       600
                ....*....|....*....|....*....|....*....|....*...
1E9Z_B      547 VDG------------------KEVTS-------KPANKVSLAQLFSIF 569
1E9Y_B      547 VDG------------------KEVTS-------KPANKVSLAQLFSIF 569
gi 15612817 549 VDG------------------EMITC-------KPFEEVALAQRYFLF 571
gi 2501621  547 ADG------------------EELSC-------QPVDYVPLGQRYFLF 569
gi 19551336 548 VNG------------------ELITS-------KPAETVPMARRYFLF 570
gi 2507520  555 IDG------------------QVWQP-------QPAAELPMTQRYFLF 577
gi 2507520  555 IDG------------------QVWQP-------QPAAELPMTQRYFLF 577
gi 15927870 549 VDG------------------EKITS-------NAATELPLTQRYFLF 571
gi 2501620  813 ADG------------------KVMEC-------EPVDKLPLSQSYFIF 835
gi 12643778 551 VDFndlenwleqsaselakklKKTSSgkyildaEPLTEAPLAQRYFLF 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap