1DPS,1QGH


Conserved Protein Domain Family
Dps

?
COG0783: Dps 
Click on image for an interactive view with Cn3D
DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism, Defense mechanisms]
linked to 3D-structure
Statistics
?
PSSM-Id: 223854
View PSSM: COG0783
Aligned: 41 rows
Threshold Bit Score: 137.017
Threshold Setting Gi: 15828628
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DPS_A    14 LLYTRNDVSDSEK-KATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAERAVQLGGVAL 92  Escherichia coli
15889746   3 THKTKNDLPSNAK-STVIGILNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAERVVQLGGTAL 81  Agrobacterium tumef...
15890216  52 LPLATPTDLATEAsREISAALTALLADVFTLYIKTKNFHWHVSGPHFRDYHTLLDEQGAQIFAMTDDIAERARKIGGTTI 131 Agrobacterium tumef...
17988263  21 MHATRNDLPSNTK-TTMIALLNENLAATIDLALITKQAHWNLKGPQFIAVHEMLDGFRAELDDHVDTIAERAVQIGGTAY 99  Brucella melitensis
19554193   1 MANYTVPGINENDaKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAERISTLGGAPV 80  Corynebacterium glu...
10957408  62 NRATTLPAAGTEDlKKSVQALQNTLTELQALQLQTKQAHWNVSGTLWYTLHELLQDHYEGISKFADDVAERQLSVGASSD 141 Deinococcus radiodu...
15791220  14 VEGSDALRMDADRaEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGEAAETAEEVADELAERVQALGGVPH 93  Halobacterium sp. N...
16122731  14 LLYTRNDVEEHVK-VATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAERAVQLGGVAL 92  Yersinia pestis
17228668  10 LYPTRIDIPAEKR-VQIVAILNQTLAATLDLKTQAKQAHWNVKGTDFYQLHELFDELAGELEEFVDLVAERVTALGGYAV 88  Nostoc sp. PCC 7120
17231300  13 QVYDNPVLLDRSVtAPVTEGLNVLLASFQALYLQYQKHHFVVEGAEFYSLHEFFNSSYNEVQDHVHEIGERLNGLGGVPA 92  Nostoc sp. PCC 7120
1DPS_A    93 GTTQVINSKTPLKSYPLDiHNVQDHLKELADRYAIVANDVRKAIG---EAKDDDTADILTAASRDLDKFLWFIECNIE 167 Escherichia coli
15889746  82 GSLQAVSSTTKLKAYPTDiYKIHDHLDALIERYGEVANMIRKAIDdsdEAGDPTTADIFTAASRDLDKSLWFLEAHVQ 159 Agrobacterium tumefac...
15890216 132 RSISHIARVKRLLDNDADfVTPEDMLAELREDNKQLTAILRQTHNltsDLNDHATTSLIENWIDETERRTWFLFETTR 209 Agrobacterium tumefac...
17988263 100 GTTQVVVKESRLKPYPTDiYAVHDHLVALIERYGDVANLVRKSIKdadDAGDDDTADIFTAASRSLDKALWFLEAHVQ 177 Brucella melitensis
19554193  81 GTPEGHVADRTPLQYERNaGNVQAHLTDLNRVYTQVLTGVRESMAs-aGPVDPVTEDIYISQAAELEKFQWFIRAHIV 157 Corynebacterium gluta...
10957408 142 GRAITIVAASRLPEIPGGfLDDAQVIQFFTYQYETVGQRIHQRVGd-vEKVDPTTANLLQEVEHIIEKYQWQMRAFLQ 218 Deinococcus radiodurans
15791220  94 ASPETLQAEASVDVEDEDvYDIRTSLANDMAIYGDIIEATREHTElaeNLGDHATAHMLREGLIELEDDAHHIEHYLE 171 Halobacterium sp. NRC-1
16122731  93 GTAQVINDKTPLKSYPTNiHSVQEHLKALAERYAIVANDIRKAIT---EVEDENSADMFTAASRDLDKFLWFIESNIE 167 Yersinia pestis
17228668  89 GTARAAAKNSILPEFPFDiLDSQEYVAALADRYAPYAKHIREAIAktdDLGDADTADLYTEISRTIDKRLWFLDAHLQ 166 Nostoc sp. PCC 7120
17231300  93 ASFSKLAELTCFEQESDGvYSSRKMVENDLAAEQAIINVIRRQAAqaeSLGDRGTRYLYEKILLKTEERAYHLAHFLA 170 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap