Conserved Protein Domain Family
LpxB

?
COG0763: LpxB 
Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 223834
View PSSM: COG0763
Aligned: 29 rows
Threshold Bit Score: 385.072
Threshold Setting Gi: 9789771
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21263765   1 MIKIYFIAGEVSGDFVGGRIMQHLKNNTGvqlnspvssfvndAVQFVGVGGKYMEEAGs--FKSLFPITSINLMGFVEIL 78
gi 14285566 221 dthCFLSAGEASGDILGGKLIQSIKSLYP-------------NIRFWGVGGPAMRQEG---LQPILNMEEFQVSGFAEVL 284
gi 14285532 225 snsCFISAGEHSGDTLGGNLLKEMHAKYP-------------DIHCFGVGGPQMRAQN---FHALFAMEKFQVSGFWEVL 288
gi 14285557   1 MKTFLVCALEPSANLHLKEVLKAYKKDFG-------------EFELHGIYDESLCKEFdlnSKPLYSSHEFSAMGFIEVL 67
gi 19703932   1 -MKFFVSTGEASGDLHLSYLVKSVKARYK-------------DVDFVGVAGEKSQKEG---VEILQDINELAIMGFTEVL 63
gi 3913997    1 MPTILVSALEASSNAHLEELRQNLPE----------------DYRFIGVF------EG---KEVLYSPREFSIMGFRDVI 55
gi 14285569   1 MKKIYFIAGEMSGDFIGGHVIQNLKSn--------------eGLEFTGIGGKYMEEAGn--FKSLFTITAINLIGFIEII 64
gi 17229766   1 -MRIFISTGEVSGDLQGALLIAALQRQAVal---------gvELEIVALGGDKMAAAG---ATILGNTSGIGSMGIFESL 67
gi 9789771    1 MPTILVSALEASSNIHLEELRHNLPK----------------DYRFIGVF------ES---KEALYSPREFSIMGFRDVI 55
gi 14285539   1 -MRIFISTGEVSGDLQGSLLVGALRQQAEeq---------nlELELVGLGGEKMAAAG---LTLLANTAAIGSVGLTESL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21263765  79 PHIFKLKKLIDKTVEDIINSKADLLITIDSPGFTYRVAKRVRKLLPKLKMIHIVAPSVWAYKEGR--AVKYAKIYDCLFA 156
gi 14285566 285 GSLFRLYRNYRKILKTILKHKPATLIFIDFPDFHLLLIKKLRKHGYRGKIIHYVCPSIWAWRPKR--KRILEQHLDMLLL 362
gi 14285532 289 LALPKLWYRYQLLYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSR--KTVLEKYLDLLLL 366
gi 14285557  68 PLIFKAKKAIKELANLSFTQKINGILCIDSPAFNIPFAKALKKAGSKIPRIYYILPQVWAWKKGR--IPIIESHFDILAS 145
gi 19703932  64 KKYKFLKQKAYEYLQYIKDNQIKNVILVDYGGFNVKFLELLKNEIKDIKIFYYIPPKVWIWGEKR---VEKLRFADYIMV 140
gi 3913997   56 GRLGFLLKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAKKIKKQDPHKKIMYYILPQVWAWKKWR--AKSLEKYCDFLGA 131
gi 14285569  65 PHLLKIKKLIDKTVEHIINSKADLLITIDSPGFTYRVAKRVRKLLPNLKMIHIVAPSVWAYKADR--AVNYAKIYDCLFA 142
gi 17229766  68 PYVVPTLIVQRRAIAYLKQNPPDLVVLIDYMGPNLGVGTYMQKHLPHVPVAYYIAPQEWVWSMSLrnTSRIVGFTDKLLA 147
gi 9789771   56 GRLGFLLKAHKEMVQ--LAKQADMVLLMDSSSFNIPLAKKIKKQDPHKKIMYYILPQVWAWKKWR--AKSLEKYCDFLGA 131
gi 14285539  68 RFIIPTWQIQQRVKRYLKTNPIDLLVLIDYMGPNLTIANYLRKTYPNLPILYYIAPQAWVWSPTKreTAQIMAVTDRLLA 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21263765 157 LLPFEPPYFTKVGLDCRYIGHPIMEQE--FYSDKIA--LREEFKIDENERVLCVTLGSRKGEILRHLSVFVSSIEEIFKS 232
gi 14285566 363 ILPFEEGLFKNTSLETVYLGHPLVEEI---SDYKEQasWKEKF-LNSDRPIVAAFPGSRRGDISRNLRIQVQAFLNSS-L 437
gi 14285532 367 ILPFEQNLFKDSALRTVYLGHPLSETI---KSFSPNlnWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASS-L 442
gi 14285557 146 ILPFDNQFFNKS----TYIGHPLLDEIkeFK-NQED--INHTFSKKDDEKTIAFLPGSRRSEIRRLMPIFKELSQKFK-- 216
gi 19703932 141 IFPWEVDFYKKHNINAIYFGNPFTDFY--------------KK-VERTGNKILLLPGSRRQEIKAMLPVFEEIINNLK-- 203
gi 3913997  132 ILPFEVGYYQKKAQY---VGHPLLDEI-------KH------YKKDIKGETLVFMPGSRKSEIAKMFPLFVKAAQMLE-Q 194
gi 14285569 143 LLPFEPPYFTKVGLDCRYIGHPIMEQE--FYRDKIA--LRKELKIDENERILCVTLGTRKGEILRHLPIFIDAIQEISKD 218
gi 17229766 148 IFPEEARYFSHNGADVTWVGHPLIDRMq-EVLSREE--ARAKLGITPEQKAIALLPASRKQELKYLLPPIFQAAQNIQAK 224
gi 9789771  132 ILPFEVGYYQKKAQY---VGHPLLDEI-------KY------YKKDIKGETLVFMPGSRKSEIAKMFPLFVKAAQILE-Q 194
gi 14285539 148 IFPGEAEFFQKQGLDVTWVGHPLLDRItkEAPSRGS--AREKLGIDHNETVITLLPASRIQELRYLLPSICGAAQQLQSQ 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21263765 233 CNNLKVIFTLANPAHEAIIKPFLEDVK--FNYLFSS-ERLKIYAVADVALAKSGTNTLEIAASGTPMIVAYKVNLISFFI 309
gi 14285566 438 SQTHQFVVSSSSAKYDEIIEDTLKAEGcqHSQIIPMnFRYELMRSCDCALAKCGTIVLETALNQTPTIVMCRLRPFDTFL 517
gi 14285532 443 ASTHHLLVSSANPEYDHLILEVLQQNRclHSHIVPSqFRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFL 522
gi 14285557 217 ---GKKILCVPSFNLEKLEVYGd------ISEFKIEsNTPKVLKKADFAFICSGTATLEAALVGTPFVLAYKAKAIDIFI 287
gi 19703932 204 --DDKFILKLNSNQDLKYTENFKKYN---NIEIIIDkKLKDIVSDCKLSVATSGTITLELALLGLPSIVVYKTTFINYLI 278
gi 3913997  195 NEGFKRRVLVVPSFFKGLDLKALYGED--IQLFEISyDAHKSLFEAEFAFICSGTATLEAALIGTPFVLAYRAKTMDFLI 272
gi 14285569 219 YKNLTIIFPLAHPDHEAIIKPFLDNIQ--FNYLFLSnERLKAYAVSDLALAKSGTNTLEISASGTPMVVAYKVNIISFII 296
gi 17229766 225 LPEAHFWIPLSLEVYRQPIEAAIKSYGl-QATIVSGqQKE-VFAAADIAITKSGTVNLELALLNIPQVVVYRLHPVTVWI 302
gi 9789771  195 NEGFKRRVLVVPSFFKGLDLKALYGED--IKLFEISyDAHKSLFEAEFAFICSGTATLEAALIGTPFALAYRAKTMDFLI 272
gi 14285539 226 LPNVKLLLPVSLKDYQPQIEQTLKEFNl-TVQLLEGkETLTAIAAADLAITKSGTVNLEIALLNVPQVILYRVSPLTMAI 304
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21263765 310 IR--LLIKIKYVTLINIIADKEIIPEFIQ--FNCRANLISNKLQELLFNSkkayEQVIESQKILQQLGFKSNRLqlnses 385
gi 14285566 518 AKyiFKILLPAYSLPNIIMNSVIFPEFIGgkKDFHPEEIATALDLLNQHG-----SKEKQKEDCRKLCKVMTTGq----- 587
gi 14285532 523 AKyiFNIILPAYSLPNIILGRTIFPEFIGgkKDFQYEDVAAALNILKTSQ-----AQEKQKDSCRDVYQAINESa----- 592
gi 14285557 288 AK--LFVKLKHIGLANIFCD-FAGKEALN------PEFLQDKVNVLNLYEaynkYDYKAFFAKVDFLKEYLQFG------ 352
gi 19703932 279 GK--YILKIGYISLPNLVLNDEIFPELIQ--KDCEAKNIEKHMKKVLENL-------PEIEEKIENMRKKVEGK------ 341
gi 3913997  273 AR--MLVNLHYIGLANIFYNALNNETPGLgeSQLHPELIQHFLSVEGLLKaykeMDRERYFKESLRLREYLKHG------ 344
gi 14285569 297 IM--LLIKIKYVSLINIIAGSEIIPEFIQ--FNCKANLISNKLKELLSNSqkryNQVVKSKKILQKLGFESNRS------ 366
gi 17229766 303 ARkiLKGSIPFASPPNLVVMKPIVPELLQ--EQATPENITQASMELLLNY----ERRKQTLADYQEMRQCLGEL------ 370
gi 9789771  273 AR--MLVNLHYIGLANIFYNALNNETPGLgeSQLHPELIQHFLSVEGLLKayeeMDRERYFKESLRLREYLKHG------ 344
gi 14285539 305 ARriFKFNLPFVSPTNIVLNRGIMPELLQ--EQATASNIAQAGLELLLNG----DRQAKIAQDYQELREALGEP------ 372
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|.
gi 21263765 386 frhdefkgklarctkvrehrlslenslvssdrddaVPSYIAAAIIKQEFLE 436
gi 14285566 588 -----------------------------------IASEEFLKRIFDTLPA 603
gi 14285532 593 -----------------------------------SSMKECLSLIFETAS- 607
gi 14285557 353 ------------------------------------SAKNLAKILNEI--- 364
gi 19703932 342 -----------------------------------AVVESYADFLVKEGK- 356
gi 3913997  345 -----------------------------------SARKIANEMAFLLNLT 360
gi 14285569 367 ------------------------------------PSYIAAKIIKQEFL- 380
gi 17229766 371 -----------------------------------GVCDRAAQEILQML-- 384
gi 9789771  345 -----------------------------------SARKIAEEMAFLLNLT 360
gi 14285539 373 -----------------------------------GVCERAAQAVLEFANG 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap