Conserved Protein Domain Family
DnaA

?
COG0593: DnaA 
Chromosomal replication initiation ATPase DnaA [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223666
View PSSM: COG0593
Aligned: 73 rows
Threshold Bit Score: 60.7617
Threshold Setting Gi: 15888255
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887675 166 MAAQATLRQGgsgplfgSPLDTRFTFDTFVEGSSNRVALAAAKTIAEAGAGavRFNPLFIHAGVGLGKTHLLQAIANAAI 245
gi 15888255     --------------------------------------------------------------------------------
gi 17987645     --------------------------------------------------------------------------------
gi 6136705    1 --MNKQLPLP-------IHQIDDATLENFYGDNNLLLLDSLRKNSSDLK-----QPFFYIWGDKGSGKTHLLRAFSNEYL 66
gi 15794209  19 CRTVNQLIFD-------FAAHDYPSFDKFLGTEN----AELVYVLRHKH-----GQFIYVWGEEGAGKSHLLQAWVAQAL 82
gi 15676960   1 ---MNQLIFD-------FAAHDYPSFDKFLGTEN----AELVYVLRHKH-----GQFIYVWGEEGAGKSHLLQAWVAQAL 61
gi 15596144   1 -MKPIQLPLS-------VRLRDDATFANYYPGANAAALGYVERLCEAEAGw--AESLIYLWGHDGVGRSHLLQAACLRFE 70
gi 15601882  22 LLENFQLPLP-------IHQLDDETLDNFYPDNNLLLLNSLRKNFTCLT-----QQFFYIWGEQSSGKSHLLKGITHHFF 89
gi 17547344   1 MALPQQLPLE-------FGATPAPTIGNFVATGNEEAVLRLSGLVAELAVGraADRLVYLWGESGSGRSHLLHAVCAQAE 73
gi 15837192   1 -MSVSQLPLA-------LRYSSDQRFETYLHAPSGLIAQLRAVVDQCS------RDWIYLVGASGSGKTHLALALCAAAE 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887675 246 DSPRNPRVVYLTAEYFMWRFATAIRDnDaltlkdtlrNIDLLVIDDMQFLQGK-MI-QHEFCHLLNMLLDSAK-----QV 318
gi 15888255   1 ----------------------------------------MHMPSDTLLLSAAaRPrMQAVDRPFRHWPPVAGreeiaRL 40
gi 17987645   1 ----------------------------------------------MRLTHRAdKK-RRERCIELCEAL----------I 23
gi 6136705   67 INQRTAIYVPLSKSQYFSTAVLENLE-----------QQELVCLDDLQSVIGNdEW-ELAIFDLFNRIKASGKt----LL 130
gi 15794209  83 EAGKNAAYIDAAS-----MPLTDAAF-----------EAEYLAVDQVEKLGN--EE-QALLFSIFNRFRNSGKg----FL 139
gi 15676960  62 EAGKNAAYIDAAS-----MPLTDAAF-----------EAEYLAVDQVEKLGN--EE-QALLFSIFNRFRNSGKg----FL 118
gi 15596144  71 QFEERTIYLPMADLVQYGPEIFDDLE-----------QCELVCIDDLDVLVGKrEW-EEGLFHLFNRLRDTGR-----RL 133
gi 15601882  90 LLQRPAIYVPLEKSQYFSPAVLENLE-----------QQQLVCLDNLQAIIGNtEW-ELAIFDLFNRIKSVENt----LL 153
gi 17547344  74 AAGFQARYLEAKAPLEAFEYDPA---------------ITIWAIDDAERLDEWa---QVAAFNLVNEVRADPHa----AL 131
gi 15837192  67 QVGQSVAYLPLQVAVGRLRDALEALE-G----------CLLVVLDGLQAIVGMrED-EIALFDFHNRARAAGI-----TL 129
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887675 319 VVAADRAPWELESLD-PRVRSRLQGG-MAIEIEGPDYDMRYEMLNRrmgsaRQDDPSFEISDEILTHVAKSVTASGRELE 396
gi 15888255  41 CRLVRQLTGEMVQLTgDRFAARRDRRrIECHIRQIAMYVCHVALGIp----MSDIGPCFGRDRTTVGHACQVVEDRRDEP 116
gi 17987645  24 DLLAASFGASGAEIR-SPLRGRQEVS-RIRQIGMYVAHTSLGMAMN-------EVALGFARDRTTVMHACHTVEDLRDDV 94
gi 6136705  131 LISADKSPSALSVKL-PDLNSRLTWG-EIYQLNSLTDEQKIKVLQL-----AAYQRGFQLSDETANFLITRLARDMHTLF 203
gi 15794209 140 LLGSEYTPQQLVIR--EDLRTRMAYC-LVYEVKPLTDQEKIDALAS-----MAAARQVTVDSEIFEYLLKHWRRDMDSLM 211
gi 15676960 119 LLGSEYTPQQLVIR--EDLRTRMAYC-LVYEVKPLTDQEKIDALAS-----MAAARQVTVDSEIFEYLLKHWRRDMDSLM 190
gi 15596144 134 LLAASKSPRELQVKL-PDLKSRLTMA-LIFQLHGLSDEDKLRALQL-----RASRRGLHLTDEVGRFILNRGSRSMNSLF 206
gi 15601882 154 VISANQSPTALPVSL-PDLASRLRWG-ESYQLVPLNDQQKIHVLQK-----NAHQRGIELPDEVANFLLKRLERDMKTLF 226
gi 17547344 132 ITAGAAAPMSMP-LR-EDLRTRLGWG-LVYWLRPLSDADKVEALLQ-----AARERGMQLSADVPQWLVTHSYRDMPSLM 203
gi 15837192 130 LYTARAIPDGLGLTL-PDLRSRVAQC-IRIALPTLDDVGRASVLRE-----RAQRRGLMLDEAAIEWLLSRGDRDLGSLV 202
                       250       260       270
                ....*....|....*....|....*....|..
gi 15887675 397 GAFNQLMFRRSFEP-NLSVDRVDELLSHLVGS 427
gi 15888255 117 AFDEFVAVLERLVVg---IFSVMKGGRDE--- 142
gi 17987645  95 EFDALVSLFEKIVNsAFTAWRMAA-------- 118
gi 6136705  204 EALDLLDKASLQAQrNLTIPFVKKILNL---- 231
gi 15794209 212 MMLDTLDNYAVTMGkRITLPLLRQLLKQQETQ 243
gi 15676960 191 MMLDTLDNYAVTMGkRITLPLLRQLLKQQETQ 222
gi 15596144 207 DLLEQLDRASLQAQrKLTIPFLKETLGW---- 234
gi 15601882 227 EALSKLDKASLQAQrKLTIPFVKEILKL---- 254
gi 17547344 204 ALLEALDTYSLARKrAVTLPLLRDMLALLK-- 233
gi 15837192 203 MLLERLDRESLATKrRVTIPFLRHVLAEGGG- 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap