Conserved Protein Domain Family
TrkA

?
COG0569: TrkA 
Trk K+ transport system, NAD-binding component [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 223643
View PSSM: COG0569
Aligned: 70 rows
Threshold Bit Score: 61.5138
Threshold Setting Gi: 15790332
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15794703   1 MKILILGNGQVGSTVAQNLAAIPNNDVTVIDIDEKALQETGSRLDVQTVFGNGASPFTLERAGAEDADLLLALSRSDETN 80
gi 20091051   1 MRLIIIGASSLGMHLTHTMIRQGNEVVLIEKDEEVARE-LAEELDCTVINAEGTHPDILEKAGMDCTDAVVACTNHDQDN 79
gi 1351544    4 ADFCIIGLGRFGMQVAQSLKENNFNLLLIDLDDKKTDTASQ--QFDYVICCDASNLTALEELQIDEFAGVIVGVTN-IEA 80
gi 2496387    4 ADFCIIGLGRFGMQVAHSLKENNFTLVLIDNDQHKTNTAAQ--EFDHVVCCDGSNLTALAELQLEEFSAVIVGVTN-IEA 80
gi 15842229   1 MRVVVMGCGRVGASVADGLSRIGHEVAIIDRDSAAFNR-LSPQFAGERVLGQGFDRDVLLRAGIQGADAFAAVSSGDNSN 79
gi 15828608   6 KDICIIGIGRFGSAISKQLLKMRKNIMLIDINPSRLKPFED--EISSLYVADATDINALKNLGIQDVETVIVSANN-NIE 82
gi 15609828   1 MRVVVMGCGRVGASVADGLSRIGHEVAIIDRDSAAFNR-LSPQFAGERVLGQGFDRDVLLRAGIQGADAFAAVSSGDNSN 79
gi 15639133   5 RNFAVVGLGAFGYRVCEVLVQGGGSVVAIDNNAQTVEKVKK--VVSVAILIDTTSETELMKAPLDDVDVAIVAIGTNLQA 82
gi 17229603   1 MYVLIGGAGLVGLTLAQKLVELGHTVAIIDVDHTACRY-AREQVGAMAFEGSAVSTEVLLEAGIRKADALAAVLRNDALN 79
gi 16331317   1 MYILIGGMGSMGSNLAKNLLKMGHTVAAVDTDPLACQY-AREKIGVMAFEGSAVNTSVLLEAGVRKAGAVIAALQEDALN 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15794703  81 IVACKVAADLFNIPGRIARVRSSEYLEYLSP-KlennengslsifgITETISPEQLVTEQLAGLIDCPGALQVLRFADD- 158
gi 20091051  80 ILIGLIAQE-AGVERVIVKTDDTKFMEIAKKlG-------------ISSPINPPHISSTIISDALRGIDTIELSNLIR-- 143
gi 1351544   81 SIMICANLRELGQKNIIAKAKNEVHKRVLSTmG-------------IREALIPEKIVGKNLVIRLIHGLENEIINLG--- 144
gi 2496387   81 SIMICANLRELGQKNIIARAKNEVHNRVLRTmG-------------IREALIPEKIVGKNLVIRLIHGMETEIINLG--- 144
gi 15842229  80 IISARLARETFGVPRVVARIYDAKRAEVYERlG--------------IPTIATVPWTTDRLLNALMQDTETAKWRDPTg- 144
gi 15828608  83 IVASLLELN---VQYIIARASSKNHSRVLKQiG-------------INVIINPEEEIGTKTALIAGNDKFIRFSEKLQEl 146
gi 15609828  80 IISARLARETFGVPRVVARIYDAKRAEVYERlG--------------IPTITTVPWTTDRLLNALMQDTETAKWRDPTg- 144
gi 15639133  83 SILTTALLKQRDIPYILARATSPIHETILRKiG-------------ANEILNIEVASATTIAKRLVAPDVTDAIAMTDDi 149
gi 17229603  80 LAMVMLA-KHYGVSHILSRMRHADFAQPLRLaGa-------------NHVISTVELSVSTMVNAIEYPQVESMMHFEQg- 144
gi 16331317  80 LALVTLS-KHYGVPQIVVRMSDGDFAEPYRLaGa-------------THIISTTELALNRVINAIEYPQVDAMMHFEQg- 144
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15794703 159 -RVRMVIIQARRGGLLVGRSIADIAqdLPDGADCQICAVYRNN------RLIVPAPQTVIIEGDEILFAAAAENIGAVIP 231
gi 20091051 144 --ADVRVISFTTGEQHAGKRISEVQ----FPENTECIGFYRNN------DFILARENPKLEEGDELLIITRSGHIDRIYE 211
gi 1351544  145 -NEIIFIRSAVNNKAFFNKRLEEIN--FRQNTDANIISIMRSNk----tVVFPLGPNTEIQPGDIITAVCQQKSLNKYLN 217
gi 2496387  145 -NDILFVRAPVNNKKLFNRTLGEIN--IREHTNANLISIMRNGk----dVVFPLGPNTQIQPGDVITAVCQLSGVNQYLR 217
gi 15842229 145 -TVAVAEVVLHEDWVGHRATDLEQAtgARIAFLIRFGTGVLPEpk---tVLQAGDKVYIAAISGRAAEAAAIAALPPSED 220
gi 15828608 147 eDDFVIGSTKLFNTKIEGRTLKSLN---LSKKGINVLLIKRGT------IVEVPTGNTVLKRNDIITIIGKTHLVTAVFE 217
gi 15609828 145 -TVAVAEVVLHEDWVGHRATDLEQAtgARIAFLIRFGTGVLPEpk---tVLQAGDKVYIAAISGRAAEAAAIAALPPSED 220
gi 15639133 150 sLREIVAPRFFTDKTLEELELREKFnvKIVAVVRTDMDIDPTGnslpkkNIYYPDNAFTFRRADRMFVLGHNRDLRELTQ 229
gi 17229603 145 -QIEVLKISIPNSCYVANRSLAEIAqdSRFPSGS-LIIGYQPHph---eDLVIPNGSTVLESGSTILIATKPGSLHQVID 219
gi 16331317 145 -QIEVLKLSIPPNCTIVGRSVAAIAqdPRFPSGT-LIIGYQANah---eDLKIPNGNTLLEDGSTILAVTKPELVRQLID 219

                ....*..
gi 15794703 232 ELRPKET 238
gi 20091051 212 KLRET-- 216
gi 1351544  218 YINPKTK 224
gi 2496387  218 YINPNDK 224
gi 15842229 221 FESGARR 227
gi 15828608 218 ILNRQRK 224
gi 15609828 221 FESGARR 227
gi 15639133 230 I------ 230
gi 17229603 220 FIEGCK- 225
gi 16331317 220 FMGLCQS 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap