1D6M,1CY7,1I7D


Conserved Protein Domain Family
TopA

?
COG0550: TopA 
DNA topoisomerase IA [Replication, recombination and repair]
linked to 3D-structure
Statistics
?
PSSM-Id: 223624
View PSSM: COG0550
Aligned: 90 rows
Threshold Bit Score: 38.357
Threshold Setting Gi: 15838444
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A        1 MRLFIAEKPSLARAIADVLPKPhrkgdgf----iecgngQVVTWCIGHLLEQAQPDAyd---------srYARWNLADLP 67
gi 15615949   3 AVVVIAEKPDQGMKLAAPFPHRnkrgyvevapcdqfpagAFFTWAVGHLCELCPPEQyd---------psWKKWTLEALP 73
gi 16077493   3 KTVVLAEKPSVGRDLARVLKChkkgng------ylegdqYIVTWALGHLVTLADPEGyg---------keFQSWRLEDLP 67
gi 15896200   3 KILVLAEKPSVARDLAKVLKAninkkt------hlegnkYVVIWALGHLVSLADPESyg---------ekYKKWSMDTLP 67
gi 15896801   3 KILVISEKPSVGRDIANVLGCktrgeg------cligakYIVTWAVGHLVTLWEPEEyn---------aiYKKWRFDTLP 67
gi 17544785   3 KALIIAEKPSVAADIARALGGFtkhdey------yesddHVLSSAVGHLVEIAAPDEye---------vkRGKWSFAHLP 67
gi 15925244   2 KSLILAEKPSVARDIADALQInqkrng------yfennqYIVTWALGHLVTNATPEQyd---------knLKEWRLEDLP 66
gi 15838376   1 ------------------------------------------------------------------mtrrSSAGRWSSCP 14
gi 15838444     --------------------------------------------------------------------------------
gi 15838651   1 MRLFIAEKPSVAKAIAGELGVtgkgeg------yiecghDTITWCFGHMLEQAEPDAyisedvplnpktgKKIWRVEELP 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A       68 IVPEKWQLQPRPsvtKQLNVIKRFL--HEASEIVHAGDPDREGQLLVDEVLDYLQLAPEkrqQVQRCLINDLNPQAVERA 145
gi 15615949  74 LIPQSFVHRVSRgkkDQFQVIRSLVhrKEVTEIVMAGDAGREGELIVRLILKQCRVKK----KTSRLWLSSLTKQAVVSG 149
gi 16077493  68 IIPEPLKLVVIKktgKQFNAVKSQLtrKDVNQIVIATDAGREGELVARWIIEKANVRKP----IKRLWISSVTDKAIKEG 143
gi 15896200  68 MLPKNMKLSVLKntsKHFYDIKKVMerKDLDELVIATDAGREGELVARWIIEMAKWKKP----IKRLWISSQTDRAVRDG 143
gi 15896801  68 IIPEVMKIKPIDgtkKQFNIIKKLMndNSVESLICATDAGREGELIFRYTYEAAECKKP----FSRLWISSMTDEAIKEG 143
gi 17544785  68 VIPPHFDLRPIAkseSRLKVLTRLIkrKDVTSLINACDAGREGELIFRLIAQHANTKLP----IQRLWLQSMTPQAIRDG 143
gi 15925244  67 IIPKYMKTVVIGktsKQFKTVKALIldNKVKDIIIATDAGREGELVARLILDKVGNKKP----IRRLWISSVTKKAIQQG 142
gi 15838376  15 LFRSSGGSRSNRr--PPRNSKVVKAllAKATHLVIATDADREGELIAREIIDLCGYRG----PIERLWLSALNDASIRTA 88
gi 15838444   1 --------------------------------------------------------------------------MARALG 6
gi 15838651  75 IIPETWIMQPREdakAQLEVIKRLL--KKATEIVNAGDPDREGQLLVDEVLEYFDCHKS----VQRFWVSAQDSVSVQRG 148
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      146 IDRLrsNSEFVPLCVSALARARADWLYGINMTRAYTILGRN--AgyqgVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFE 223
gi 15615949 150 FHQLksAESTEPLYHEALSRSCADWLIGMNVTRAYTLLLKKk-Gvd-sLFSTGRVQTPTLALIVKREKEIEAFESKPFWE 227
gi 16077493 144 FQKLrsGKEYENLYHSAVARAEADWIVGINATRALTTKfn-------aQLSCGRVQTPTLAMIAKREADIQAFTPVPYYG 216
gi 15896200 144 FAHLrdGRDYENLYKSAKCRSEADWFVGLNVTRALTCKyn-------aQLSAGRVQTPTLYMIVSREEEIRKFKPKDYYT 216
gi 15896801 144 FSTIkpGTEYDNLYHSAKCRSEADWLVGMNASRAYTLKyn-------vLLSVGRVQTPTLAIIVKRQKEIDNFEPKDYWE 216
gi 17544785 144 FAQLrsDNEMLPLADAARCRSEADWLVGINGTRAMTAFNSKggGf--fLTTVGRVQTPTLSIVVEREEKIKRFVPRDYWE 221
gi 15925244 143 FKNLkdGRQYNDLYYAALARSEADWIVGINATRALTTKyd-------aQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFT 215
gi 15838376  89 LGKLrpSSDTLPMYYSALARSRADWLVGMNLSRLFTVLGLQa-Gyd-gVLSVGRVQTPTLKLVVDRDREIAAFKSVPFWA 166
gi 15838444   7 FAALrsNTEYQGFANAARARSRADWLIGINFSRAYTLRTQR--GgsraLLRR---------------------------- 56
gi 15838651 149 LAALrsNTAYQGFANAARARSRADWLIGINFSRAYTLRAQR--GgsraLLTIGRVQTPTLALVVMRDREIEAFKSIPYHT 226
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      224 VKAHIVTPADEr----FTAIWQPSEAcepyqDEEGRLLHRPLAEHVVNRIS-GQPAIVTSYNDKRESESAPLPFSLSALQ 298
gi 15615949 228 VKATFRVQGHE-----YEGIWHK--------DRETRLFDQPMAEAIAAFCR-GKQGKVTKVKKETKTLKPPYLFNLSSLQ 293
gi 16077493 217 IRA--AVDG-------MTLTWQDKK------SKQTRTFNQDVTSRLLKNLQ-GKQAVVAELKKTAKKSFAPALYDLTELQ 280
gi 15896200 217 IEG--KVKS-------FSMNWHDK-------SGDFKIFNKERAEKIEALVK-GSKGKIVDVSESKKKKYSPALYDLTELQ 279
gi 15896801 217 VVS--KYEG-------FNGTWFDKE------TKESKIMDKKKADDLGAKIL-GQTGKVISIENKKKKQVPPLLYDLTELQ 280
gi 17544785 222 VRAEFIAAAGLyegrwFDPKFKKSEFdp--eQRESRLWSEAEALSIVAACR-DKPGMVTEESK-PSTQMSPALFDLTSLQ 297
gi 15925244 216 LSL--TVKG-------FDFQLESN--------Q--RYTNKETLEQMVNNLK-NVDGKIKSVATKHKKSYPQSLYNLTDLQ 275
gi 15838376 167 IDVSLSAGGQA-----FSAQWVPPDGc---tDDAGRCLQQPIAQQAAQQIRaASSAQVVSVETERVREGPPLLFDLGTLQ 238
gi 15838444     --------------------------------------------------------------------------------
gi 15838651 227 IRAAFKHEGGVf-----VAVWRAKEdqv-glDPEGRLVDTVIANTLVESIT-GHIGKVIEYKQEPKKKAQPRAYSLSDMT 299
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      299 IEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFAGRHAVMNAISv-------HAPDLLPQpv-vdPDIRN 370
gi 15615949 294 ATANKRFTFSPKKTLDVAQKLYVK-GHISYPRTDSSFLTAEEGKAAKRIVQLLKqe----daYASLFPLDrd--nLLQDR 366
gi 16077493 281 RDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEvk-----pYAQYVSQIkk-rgIKSHK 354
gi 15896200 280 RDANRFFGFSAKETLSIMQRLYENHKLLTYPRTDSRYIPHDVVATLPDRLRAISig-----kYSKFAAEIlr-skINVHK 353
gi 15896801 281 RDCNKKFGFSAQKTLDIVQSLYEKRKMVTYPRTDSRYLSHDMVNKIKKTIGRLNin-----pYDKYVGEIlklskLPMGK 355
gi 17544785 298 REANSRFGFSAKNTLGLAQALYEKHKVLTYPRTDSRALPEDYLGTVRQTLDMLAdsshnylpHAKKILASq---wVKPNK 374
gi 15925244 276 QDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVDTMKERIQATMat-----tYKDQARPLms-ktFSSKM 349
gi 15838376 239 EVCSKQLGLDVQETLEIAQALYETHKATTYPRSDSGYLPESMFAEVPTVLDSll-------kTDPSLRPImgqldRSQRS 311
gi 15838444     --------------------------------------------------------------------------------
gi 15838651 300 LLASNKFGYSAADVLEVCQSLYETHKLTSYPRTDCGYLPESQHADAPHVLEAIKh-------VYPEVAVLvdganQNIKS 372
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      371 RCWDDKKVDAHHAIIPT-ARSSAINlt-eNEAKVYNLIARQYLMQFCPDAVFRKCVIELDIAKG-KFVAKARFLAEAGWR 447
gi 15615949 367 RYVNQSKVTDHYAIIPTdDVPKVQTla-kDEQLLYDLIVRQFLAAHMREAKIAYTEVETLVDERaTFLTKGKQLLDQGWK 445
gi 16077493 355 GYVNDAKVSDHHAIIPT-EEPLVLSslsdKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGE-TFTAKGKTVQSQGWK 432
gi 15896200 354 GFVDDSKVTDHYAIIPT-EERPALGalsnEEFKIYDLVVKRFLSIMLPPFEYIQTTVKAEVAGE-IFIAKGKVVKSKGWK 431
gi 15896801 356 RIIDDSKVTDHHAIIPT-DVKPNLStltkDELKVYDAIVRRFLCVFYPNYEYTITKIVTEVVEE-NFLTQGKTILKLGWM 433
gi 17544785 375 RIFDNSKISDHFAIIPTlQAPKNLSe---PEQKLYDLVVRRFLAVFFPAAEYLVTTRVTEVAGH-HFKTEGKVLVNPGWL 450
gi 15925244 350 SIFNNQKVSDHHAIIPT-EVRPVMSdlsnRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGH-TFVLKENVTTVLGFK 427
gi 15838376 312 RAWNDGKVTAHHGIIPT-LEPANLSamseKELAVYRLIRAHYLAQFLPHHEFDRTIAELSCGQQ-KLVATGKQVAAQGWH 389
gi 15838444     --------------------------------------------------------------------------------
gi 15838651 373 KTWDDSKITAHHGIIPT-MHKGSMAnlseKERNIYDLIVRVYLAQFYLQHEYLATTVTLEVAGE-RFDVGGKVVTRNGWR 450
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      448 TLLGSke------rdEENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMtgiarfvqd--kdlkkilrAT 519
gi 15615949 446 QIIGLsk---------dDKDEDIPPLEEGWTGDVKHADVREGKTKPPSRYTEGQLITLMktvgkhved--delekvlmRT 514
gi 16077493 433 AVYDMaeed---deqEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFNEGTLLSAMenpsafmqgeekglvktlgET 509
gi 15896200 432 EVYDKtedf---eekSELKDQMLPEMNKGEDITFSTVSIKKGQTKPPSRFTEATLLSAMenpqryvsm-dkisaktlgET 507
gi 15896801 434 EFYKHdkke---kddENSEPDELPKLKKNESVQVKDSEIKAKKTKAPSSYTEASLLSAMenagrfved--eqlkeqlkD- 507
gi 17544785 451 VVYGResq----skdDKENGNLVP-VAKAEKVKTDKVEPVSLTTKPPARYNEATLLSAMegagklvd---ddalreamAG 522
gi 15925244 428 SIRq-----------GESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMenpqnfiqlkdkkyaqtlkQT 496
gi 15838376 390 LVLAEpqad--edgeTTARSQVLPALREGLACQVAEAEVKALKTLPPKPYTQGELVKSMkgvarfvtd--prlkqklkDT 465
gi 15838444     --------------------------------------------------------------------------------
gi 15838651 451 DVYIEaeeeaegeseSGSNNQALPNMQNGDVVSCVKATRIDAKTKAPSRFTEGTLTRAMenihkyvtd--aehkkllrDG 528
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1D6M_A      520 DGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSLPEM----ATRPDMTAHWESVLTQISEKQCRYQDFMQPL 595
gi 15615949 515 EGLGTEATRAGIITLLKDRQYIEIKKNVVYATEKGKLLIEALGPSl---LASPEMTAKWEQRLFEIGRGQADAHAFMEQV 591
gi 16077493 510 GGLGTVATRADIIEKLFNSFLIEKKGQDIFITSKGKQLLQLVPED----LKSPALTAEWEQKLSAIAAGKlksavfikdm 585
gi 15896200 508 GGLGTVATRADIIEKLYKTFYIEKKGNEIVPTSKGKQLVNLVPSD----LKSPLLTAKWEGQLDAISKGKLNGVSFVNEI 583
gi 15896801 508 GGLGTPATRASIIERLIQVGYIQRKGKSLHPTDKGMKLIEIVPYE----LRSPETTGKWEKGLSSISKGKMASERFMQSI 583
gi 17544785 523 KGLGTPATRAAIIEGLLTEKYLLREGRELIPTAKAFQLMTLLRGLgveeLTQAELTGEWEHKLAQIERGRLARDEFMREI 602
gi 15925244 497 GGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEE----LTSPLLTAQWEEKLLLIERGKYQAKTFINEM 572
gi 15838376 466 TGIGTEATRANIITGLLTRGYLVKKGRSIRASDAAFTLIDAVPAA----IADPGTTAVWEQALDMIEAGQLTLDVFIGKQ 541
gi 15838444     --------------------------------------------------------------------------------
gi 15838651 529 DGIGTSATRASIISELKRRQFLEVKGKQIVSTTLGRSMIDALPEV----VKSPVLTALYERMLLSIGEGRLEVDSFITKQ 604
                       650       660
                ....*....|....*....|....*..
1D6M_A      596 VGTLYQLIDQAK----RTPVRQFRGIV 618
gi 15615949 592 KKLSDHLVKEAHqranTWDFSSFDQEA 618
gi 16077493 586 kayahqtvkeiknssqtfrhdnitgta 612
gi 15896200 584 KGYASKLVDDVKgskdTFKYDNLTGTK 610
gi 15896801 584 KRYVQYIIQESVkvnrSVVFQNND-SK 609
gi 17544785 603 AQMTQQIVKRAKeydsDTIPGDYATLS 629
gi 15925244 573 KDFTKDVVNGIKnsdrKYKHDNLTtte 599
gi 15838376 542 AAWISQLIVQYGstslSIKVPQGPACP 568
gi 15838444     ---------------------------
gi 15838651 605 EAFIREQIAKANd--gALKLNGAKESP 629
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap