1D6M,1CY7,1I7D


Conserved Protein Domain Family
TopA

?
COG0550: TopA 
DNA topoisomerase IA [Replication, recombination and repair]
linked to 3D-structure
Statistics
?
PSSM-Id: 223624
View PSSM: COG0550
Aligned: 90 rows
Threshold Bit Score: 38.357
Threshold Setting Gi: 15838444
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1D6M_A     1 MRLFIAEKPSLARAIADVLPKPhrkgdgf----iecgngQVVTWCIGHLLEQAQPDAyd---------srYARWNLADLP 67  Escherichia coli
15615949   3 AVVVIAEKPDQGMKLAAPFPHRnkrgyvevapcdqfpagAFFTWAVGHLCELCPPEQyd---------psWKKWTLEALP 73  Bacillus halodurans
16077493   3 KTVVLAEKPSVGRDLARVLKChkkgng------ylegdqYIVTWALGHLVTLADPEGyg---------keFQSWRLEDLP 67  Bacillus subtilis
15896200   3 KILVLAEKPSVARDLAKVLKAninkkt------hlegnkYVVIWALGHLVSLADPESyg---------ekYKKWSMDTLP 67  Clostridium acetobu...
15896801   3 KILVISEKPSVGRDIANVLGCktrgeg------cligakYIVTWAVGHLVTLWEPEEyn---------aiYKKWRFDTLP 67  Clostridium acetobu...
17544785   3 KALIIAEKPSVAADIARALGGFtkhdey------yesddHVLSSAVGHLVEIAAPDEye---------vkRGKWSFAHLP 67  Ralstonia solanacearum
15925244   2 KSLILAEKPSVARDIADALQInqkrng------yfennqYIVTWALGHLVTNATPEQyd---------knLKEWRLEDLP 66  Staphylococcus aure...
15838376   1 ------------------------------------------------------------------mtrrSSAGRWSSCP 14  Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651   1 MRLFIAEKPSVAKAIAGELGVtgkgeg------yiecghDTITWCFGHMLEQAEPDAyisedvplnpktgKKIWRVEELP 74  Xylella fastidiosa ...
1D6M_A    68 IVPEKWQLQPRPsvtKQLNVIKRFL--HEASEIVHAGDPDREGQLLVDEVLDYLQLAPEkrqQVQRCLINDLNPQAVERA 145 Escherichia coli
15615949  74 LIPQSFVHRVSRgkkDQFQVIRSLVhrKEVTEIVMAGDAGREGELIVRLILKQCRVKK----KTSRLWLSSLTKQAVVSG 149 Bacillus halodurans
16077493  68 IIPEPLKLVVIKktgKQFNAVKSQLtrKDVNQIVIATDAGREGELVARWIIEKANVRKP----IKRLWISSVTDKAIKEG 143 Bacillus subtilis
15896200  68 MLPKNMKLSVLKntsKHFYDIKKVMerKDLDELVIATDAGREGELVARWIIEMAKWKKP----IKRLWISSQTDRAVRDG 143 Clostridium acetobu...
15896801  68 IIPEVMKIKPIDgtkKQFNIIKKLMndNSVESLICATDAGREGELIFRYTYEAAECKKP----FSRLWISSMTDEAIKEG 143 Clostridium acetobu...
17544785  68 VIPPHFDLRPIAkseSRLKVLTRLIkrKDVTSLINACDAGREGELIFRLIAQHANTKLP----IQRLWLQSMTPQAIRDG 143 Ralstonia solanacearum
15925244  67 IIPKYMKTVVIGktsKQFKTVKALIldNKVKDIIIATDAGREGELVARLILDKVGNKKP----IRRLWISSVTKKAIQQG 142 Staphylococcus aure...
15838376  15 LFRSSGGSRSNRr--PPRNSKVVKAllAKATHLVIATDADREGELIAREIIDLCGYRG----PIERLWLSALNDASIRTA 88  Xylella fastidiosa ...
15838444   1 --------------------------------------------------------------------------MARALG 6   Xylella fastidiosa ...
15838651  75 IIPETWIMQPREdakAQLEVIKRLL--KKATEIVNAGDPDREGQLLVDEVLEYFDCHKS----VQRFWVSAQDSVSVQRG 148 Xylella fastidiosa ...
1D6M_A   146 IDRLrsNSEFVPLCVSALARARADWLYGINMTRAYTILGRN--AgyqgVLSVGRVQTPVLGLVVRRDEEIENFVAKDFFE 223 Escherichia coli
15615949 150 FHQLksAESTEPLYHEALSRSCADWLIGMNVTRAYTLLLKKk-Gvd-sLFSTGRVQTPTLALIVKREKEIEAFESKPFWE 227 Bacillus halodurans
16077493 144 FQKLrsGKEYENLYHSAVARAEADWIVGINATRALTTKfn-------aQLSCGRVQTPTLAMIAKREADIQAFTPVPYYG 216 Bacillus subtilis
15896200 144 FAHLrdGRDYENLYKSAKCRSEADWFVGLNVTRALTCKyn-------aQLSAGRVQTPTLYMIVSREEEIRKFKPKDYYT 216 Clostridium acetobu...
15896801 144 FSTIkpGTEYDNLYHSAKCRSEADWLVGMNASRAYTLKyn-------vLLSVGRVQTPTLAIIVKRQKEIDNFEPKDYWE 216 Clostridium acetobu...
17544785 144 FAQLrsDNEMLPLADAARCRSEADWLVGINGTRAMTAFNSKggGf--fLTTVGRVQTPTLSIVVEREEKIKRFVPRDYWE 221 Ralstonia solanacearum
15925244 143 FKNLkdGRQYNDLYYAALARSEADWIVGINATRALTTKyd-------aQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFT 215 Staphylococcus aure...
15838376  89 LGKLrpSSDTLPMYYSALARSRADWLVGMNLSRLFTVLGLQa-Gyd-gVLSVGRVQTPTLKLVVDRDREIAAFKSVPFWA 166 Xylella fastidiosa ...
15838444   7 FAALrsNTEYQGFANAARARSRADWLIGINFSRAYTLRTQR--GgsraLLRR---------------------------- 56  Xylella fastidiosa ...
15838651 149 LAALrsNTAYQGFANAARARSRADWLIGINFSRAYTLRAQR--GgsraLLTIGRVQTPTLALVVMRDREIEAFKSIPYHT 226 Xylella fastidiosa ...
1D6M_A   224 VKAHIVTPADEr----FTAIWQPSEAcepyqDEEGRLLHRPLAEHVVNRIS-GQPAIVTSYNDKRESESAPLPFSLSALQ 298 Escherichia coli
15615949 228 VKATFRVQGHE-----YEGIWHK--------DRETRLFDQPMAEAIAAFCR-GKQGKVTKVKKETKTLKPPYLFNLSSLQ 293 Bacillus halodurans
16077493 217 IRA--AVDG-------MTLTWQDKK------SKQTRTFNQDVTSRLLKNLQ-GKQAVVAELKKTAKKSFAPALYDLTELQ 280 Bacillus subtilis
15896200 217 IEG--KVKS-------FSMNWHDK-------SGDFKIFNKERAEKIEALVK-GSKGKIVDVSESKKKKYSPALYDLTELQ 279 Clostridium acetobu...
15896801 217 VVS--KYEG-------FNGTWFDKE------TKESKIMDKKKADDLGAKIL-GQTGKVISIENKKKKQVPPLLYDLTELQ 280 Clostridium acetobu...
17544785 222 VRAEFIAAAGLyegrwFDPKFKKSEFdp--eQRESRLWSEAEALSIVAACR-DKPGMVTEESK-PSTQMSPALFDLTSLQ 297 Ralstonia solanacearum
15925244 216 LSL--TVKG-------FDFQLESN--------Q--RYTNKETLEQMVNNLK-NVDGKIKSVATKHKKSYPQSLYNLTDLQ 275 Staphylococcus aure...
15838376 167 IDVSLSAGGQA-----FSAQWVPPDGc---tDDAGRCLQQPIAQQAAQQIRaASSAQVVSVETERVREGPPLLFDLGTLQ 238 Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651 227 IRAAFKHEGGVf-----VAVWRAKEdqv-glDPEGRLVDTVIANTLVESIT-GHIGKVIEYKQEPKKKAQPRAYSLSDMT 299 Xylella fastidiosa ...
1D6M_A   299 IEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEHFAGRHAVMNAISv-------HAPDLLPQpv-vdPDIRN 370 Escherichia coli
15615949 294 ATANKRFTFSPKKTLDVAQKLYVK-GHISYPRTDSSFLTAEEGKAAKRIVQLLKqe----daYASLFPLDrd--nLLQDR 366 Bacillus halodurans
16077493 281 RDAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEvk-----pYAQYVSQIkk-rgIKSHK 354 Bacillus subtilis
15896200 280 RDANRFFGFSAKETLSIMQRLYENHKLLTYPRTDSRYIPHDVVATLPDRLRAISig-----kYSKFAAEIlr-skINVHK 353 Clostridium acetobu...
15896801 281 RDCNKKFGFSAQKTLDIVQSLYEKRKMVTYPRTDSRYLSHDMVNKIKKTIGRLNin-----pYDKYVGEIlklskLPMGK 355 Clostridium acetobu...
17544785 298 REANSRFGFSAKNTLGLAQALYEKHKVLTYPRTDSRALPEDYLGTVRQTLDMLAdsshnylpHAKKILASq---wVKPNK 374 Ralstonia solanacearum
15925244 276 QDMYRRYKIGPKETLNTLQSLYERHKVVTYPRTDSNYLTTDMVDTMKERIQATMat-----tYKDQARPLms-ktFSSKM 349 Staphylococcus aure...
15838376 239 EVCSKQLGLDVQETLEIAQALYETHKATTYPRSDSGYLPESMFAEVPTVLDSll-------kTDPSLRPImgqldRSQRS 311 Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651 300 LLASNKFGYSAADVLEVCQSLYETHKLTSYPRTDCGYLPESQHADAPHVLEAIKh-------VYPEVAVLvdganQNIKS 372 Xylella fastidiosa ...
1D6M_A   371 RCWDDKKVDAHHAIIPT-ARSSAINlt-eNEAKVYNLIARQYLMQFCPDAVFRKCVIELDIAKG-KFVAKARFLAEAGWR 447 Escherichia coli
15615949 367 RYVNQSKVTDHYAIIPTdDVPKVQTla-kDEQLLYDLIVRQFLAAHMREAKIAYTEVETLVDERaTFLTKGKQLLDQGWK 445 Bacillus halodurans
16077493 355 GYVNDAKVSDHHAIIPT-EEPLVLSslsdKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGE-TFTAKGKTVQSQGWK 432 Bacillus subtilis
15896200 354 GFVDDSKVTDHYAIIPT-EERPALGalsnEEFKIYDLVVKRFLSIMLPPFEYIQTTVKAEVAGE-IFIAKGKVVKSKGWK 431 Clostridium acetobu...
15896801 356 RIIDDSKVTDHHAIIPT-DVKPNLStltkDELKVYDAIVRRFLCVFYPNYEYTITKIVTEVVEE-NFLTQGKTILKLGWM 433 Clostridium acetobu...
17544785 375 RIFDNSKISDHFAIIPTlQAPKNLSe---PEQKLYDLVVRRFLAVFFPAAEYLVTTRVTEVAGH-HFKTEGKVLVNPGWL 450 Ralstonia solanacearum
15925244 350 SIFNNQKVSDHHAIIPT-EVRPVMSdlsnRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGH-TFVLKENVTTVLGFK 427 Staphylococcus aure...
15838376 312 RAWNDGKVTAHHGIIPT-LEPANLSamseKELAVYRLIRAHYLAQFLPHHEFDRTIAELSCGQQ-KLVATGKQVAAQGWH 389 Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651 373 KTWDDSKITAHHGIIPT-MHKGSMAnlseKERNIYDLIVRVYLAQFYLQHEYLATTVTLEVAGE-RFDVGGKVVTRNGWR 450 Xylella fastidiosa ...
1D6M_A   448 TLLGSke------rdEENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMtgiarfvqd--kdlkkilrAT 519 Escherichia coli
15615949 446 QIIGLsk---------dDKDEDIPPLEEGWTGDVKHADVREGKTKPPSRYTEGQLITLMktvgkhved--delekvlmRT 514 Bacillus halodurans
16077493 433 AVYDMaeed---deqEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFNEGTLLSAMenpsafmqgeekglvktlgET 509 Bacillus subtilis
15896200 432 EVYDKtedf---eekSELKDQMLPEMNKGEDITFSTVSIKKGQTKPPSRFTEATLLSAMenpqryvsm-dkisaktlgET 507 Clostridium acetobu...
15896801 434 EFYKHdkke---kddENSEPDELPKLKKNESVQVKDSEIKAKKTKAPSSYTEASLLSAMenagrfved--eqlkeqlkD- 507 Clostridium acetobu...
17544785 451 VVYGResq----skdDKENGNLVP-VAKAEKVKTDKVEPVSLTTKPPARYNEATLLSAMegagklvd---ddalreamAG 522 Ralstonia solanacearum
15925244 428 SIRq-----------GESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMenpqnfiqlkdkkyaqtlkQT 496 Staphylococcus aure...
15838376 390 LVLAEpqad--edgeTTARSQVLPALREGLACQVAEAEVKALKTLPPKPYTQGELVKSMkgvarfvtd--prlkqklkDT 465 Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651 451 DVYIEaeeeaegeseSGSNNQALPNMQNGDVVSCVKATRIDAKTKAPSRFTEGTLTRAMenihkyvtd--aehkkllrDG 528 Xylella fastidiosa ...
1D6M_A   520 DGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSLPEM----ATRPDMTAHWESVLTQISEKQCRYQDFMQPL 595 Escherichia coli
15615949 515 EGLGTEATRAGIITLLKDRQYIEIKKNVVYATEKGKLLIEALGPSl---LASPEMTAKWEQRLFEIGRGQADAHAFMEQV 591 Bacillus halodurans
16077493 510 GGLGTVATRADIIEKLFNSFLIEKKGQDIFITSKGKQLLQLVPED----LKSPALTAEWEQKLSAIAAGKlksavfikdm 585 Bacillus subtilis
15896200 508 GGLGTVATRADIIEKLYKTFYIEKKGNEIVPTSKGKQLVNLVPSD----LKSPLLTAKWEGQLDAISKGKLNGVSFVNEI 583 Clostridium acetobu...
15896801 508 GGLGTPATRASIIERLIQVGYIQRKGKSLHPTDKGMKLIEIVPYE----LRSPETTGKWEKGLSSISKGKMASERFMQSI 583 Clostridium acetobu...
17544785 523 KGLGTPATRAAIIEGLLTEKYLLREGRELIPTAKAFQLMTLLRGLgveeLTQAELTGEWEHKLAQIERGRLARDEFMREI 602 Ralstonia solanacearum
15925244 497 GGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPEE----LTSPLLTAQWEEKLLLIERGKYQAKTFINEM 572 Staphylococcus aure...
15838376 466 TGIGTEATRANIITGLLTRGYLVKKGRSIRASDAAFTLIDAVPAA----IADPGTTAVWEQALDMIEAGQLTLDVFIGKQ 541 Xylella fastidiosa ...
15838444     -------------------------------------------------------------------------------- Xylella fastidiosa ...
15838651 529 DGIGTSATRASIISELKRRQFLEVKGKQIVSTTLGRSMIDALPEV----VKSPVLTALYERMLLSIGEGRLEVDSFITKQ 604 Xylella fastidiosa ...
1D6M_A   596 VGTLYQLIDQAK----RTPVRQFRGIV 618 Escherichia coli
15615949 592 KKLSDHLVKEAHqranTWDFSSFDQEA 618 Bacillus halodurans
16077493 586 kayahqtvkeiknssqtfrhdnitgta 612 Bacillus subtilis
15896200 584 KGYASKLVDDVKgskdTFKYDNLTGTK 610 Clostridium acetobutylicum
15896801 584 KRYVQYIIQESVkvnrSVVFQNND-SK 609 Clostridium acetobutylicum
17544785 603 AQMTQQIVKRAKeydsDTIPGDYATLS 629 Ralstonia solanacearum
15925244 573 KDFTKDVVNGIKnsdrKYKHDNLTtte 599 Staphylococcus aureus subsp. aureus Mu50
15838376 542 AAWISQLIVQYGstslSIKVPQGPACP 568 Xylella fastidiosa 9a5c
15838444     --------------------------- Xylella fastidiosa 9a5c
15838651 605 EAFIREQIAKANd--gALKLNGAKESP 629 Xylella fastidiosa 9a5c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap