Conserved Protein Domain Family
ClpA

?
COG0542: ClpA 
ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 223616
View PSSM: COG0542
Aligned: 128 rows
Threshold Bit Score: 80.0162
Threshold Setting Gi: 18202342
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  109 SKIRKAKERILRELEYARRYgdwwtaetlelelRQLEATEQSIRRQLEQVEKSLstVFAPEDVKAFLENKLSIDGLIRKA 188
gi 15594714    1 MYDRRALNCLFFNTFLFFMEs------------RHLVFTEEHIFYGLIKSDKVK--ELLNLCAIDFYKLNKQLEEFFSKL 66
gi 15595179    1 -------MVEIDSKEIARKN-------------KNKEVSIWHLLMSIITTPKKs--EIKFIDSKTLKNIKQEVISEIDKL 58
gi 19552964    1 ----------------------------------------------------------MNSRGLPHTTNHYKKEPPTVPF 22
gi 19552991      --------------------------------------------------------------------------------
gi 19074942    5 KYTERAQNALKMCVDEALAN-------------NNNTIEPEHLLKAILSDQTSv--LHNVLSPTERNNVKNALIKRIGGF 69
gi 18202342      --------------------------------------------------------------------------------
gi 15678312      --------------------------------------------------------------------------------
gi 15597921      --------------------------------------------------------------------------------
gi 12230885      --------------------------------------------------------------------------------
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  189 LEKSPLieqvkelgISPdriidkvaekvfgkkptfdySQYLTQVLEKAQDKAVSE--GEAQVQPSHISAALIEAK-DTIG 265
gi 15594714   67 PLRGNYipdyvssmDYLyddi------------isvlFFYKKPYKIQEKDLLWVLvkKRKNSILDALLSSGFNLTiFDKL 134
gi 15595179   59 EKILIEk------nEII--------------------IPKINKEIFALIKEAKKEfkSKPLIGAKEIFYQILKNK-KLLK 111
gi 19552964   23 HDFTD--------------------------------PDSDPRQNAPANPTAQPP-----SAPTSHSSQQGLPPG----- 60
gi 19552991      --------------------------------------------------------------------------------
gi 19074942   70 AKQYNCt------------------------------EPRVGETLAKVLMAAESKg-EGEYVSVNALVLSLLEVE----- 113
gi 18202342      --------------------------------------------------------------------------------
gi 15678312      --------------------------------------------------------------------------------
gi 15597921      --------------------------------------------------------------------------------
gi 12230885      --------------------------------------------------------------------------------
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  266 GKLINQVLGGEK------EMKKDVTQ-------------ELKEEEKS---------PLERFGVNLNELARQGKLDPVIGR 317
gi 15594714  135 IEAHDYLAVNTKsasgdsELIAEYIHnnapkrkggfhifDDKRDELDqnnifleskDSIGNFLTNVIDTLDLKYNPLIGR 214
gi 15595179  112 KHKLSKSSFNFKd----qNILEYMEKnkir------lieTYKEFDEEirle-nehfEIGKYVKNLTALAKAKKLDPLVGR 180
gi 19552964   61 -AIMIPFPGQPQ---------QQ-----------------S---------------APNDETRFIDLNERHKDDEPALFR 98
gi 19552991    1 ----MTQVVAGTlv--geSINREID-------------------E------------DKYPYLSSYAAPVAVPVREIIGR 43
gi 19074942  114 --SIRELIANSEdi--rkKVEEQTKnk----------rfDSRNADDGt-------dVMSRFAVDMVEQARQNVFDPVIGR 172
gi 18202342      --------------------------------------------------------------------------------
gi 15678312    1 -------------------------------------------------------mAVWQDNLKRLLNQKEVLIIHGNIR 25
gi 15597921    1 ---------------------------------------------------------MALGAICCGHDTRCERLSMPGTA 23
gi 12230885      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  318 EREINQVIEILLRRTKNNPVLVG-DPGVGKTAIVEGLAQRIVNKEVPPE--LQDKEIWSIDMASLLAGSKYRGEFEERLK 394
gi 15594714  215 SQELSRLIQVILRKHKSNPILFG-EPGVGKTVLIQGLAYKIKIENVPKD--LIGYEIYSLDIGRLVSGTKYRGDLESRVN 291
gi 15595179  181 EAEIKTLTNILLRRNKNSAMLIG-EPGVGKTAIVEGLASSIVQKKISSK--LQDKTILMLKVSNLVSGTKYRGEFEDRLN 257
gi 19552964   99 DDVIDQTLAILISKNKPNALLVG-PAGTGKSRIAEDIARRLANDDVSIPdqLVGHRILDVSIAELVAGAGVVGQLEERIL 177
gi 19552991   44 EEEVNKIMAALMRPEISNVMLVG-PAGSGKTTLVQQALVKDPERNYIEV---DVAKMVADLSTPAQMAARIKGVFEDAIA 119
gi 19074942  173 DEEIRRVLEILSKKTKSNAILVG-KPGVGKTAIVNGIAQLIANGEAPT---LRGARIYNVDVGSMVAGTSHRGDFEERLK 248
gi 18202342      --------------------------------------------------------------------------------
gi 15678312   26 DTAYLTEEGNLVRGLTDLINRTGrELGYDKTVSWGSFFDHEGRGHSPMWs-LERITPLNGDQPEIRETESQDRVSDVLHR 104
gi 15597921   24 LFEKPRWLRDLLRFLPLKSQFVL---SGN---IRDLQACEVVPGTVTAQ---SFNQTLCDALLDAGYAQVLAWDPLAGFR 94
gi 12230885      --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  395 ALLDEVK-EKgNVILFIDEIHTVVGAG---AaEgAVDAANIMKPALARGEIRVIGATTVDEYRKYIEKDPALERRFQPVF 470
gi 15594714  292 RVLDFLSsRK-KVMLFIDEIHMIVGAGat--sFgSMDISNLLKPILTLGKIKFIGATTEYEYRKFFLKDKALMRRFQSIE 368
gi 15595179  258 NIIKYIEkNK-NTIIFIDEIHTLIGAGnseG---ALDASNILKPSLSRAEIQIIGATTYNEYRKYISKDKAFARRFQTIT 333
gi 19552964  178 DLIKYATdPSnKVIIFIDEIHQIAGDQsshS-GsQAKVAQILKPYLARGDLRVIGATTTQEAR-DFDHDPALKRRFSRVN 255
gi 19552991  120 YRKHEGH----ELVLFVDEFHQIVQLSna-----aVEAIKPILAMSGVLGVRVIAATTLEEFHEHIRPNQALTERLQEIR 190
gi 19074942  249 TLVKEAEtTP-GVILFIDEIHIVLGAGktdG---AMDAANMLKPGLAAGTIKCIGATTHDEYRKYIENDPAFERRFVQVV 324
gi 18202342      --------------------------------------------------------------------------------
gi 15678312  105 WLEDEITsIDeKKIFIINYIDKITGYAp---------DGMYSEPTAELVTLIQKIIENISENNRLIMIALRDTMIPVEYY 175
gi 15597921   95 VLGRPGSeAGaTPQVLLDLGLTPVDGAapaG----IDLLGATLQRLVNRSGEPIALIVDFASR-LAVRNDALSAAEHQLF 169
gi 12230885      --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  471 VDEPTEEQTIEILKGLRPRLEQFHK--VKISDEAIEAAVKLTKRYVT-FRRLPDKAIDALDQAAARKKLKVIgTPPEIQE 547
gi 15594714  369 LKEPNFEDAYNILQEIKKDYERYHN--VEYTDEAIQACILMSQKYIK-DRFLPDKAFDILDELGSKFKLEN--------- 436
gi 15595179  334 VKEPDEKDTLKIIENIAKNFEDYHG--VIYEKSALLNIVKLSSKYLI-NKRFPDKAIDIIDIAGAIKKEE---------- 400
gi 19552964  256 VDEFDRDQTLTILHAARDGYLKHFNnaVTVSDDVLGYVYTYSQQFNPgNTAQPDAALTLFDKALASLTME---------- 325
gi 19552991  191 LTPTDQKTTVAILRGMADRYGVSDQ---FYDDHVFEQIYSTTERFMP-SSVQPRKSIRVLDAMVGWHRLS---------- 256
gi 19074942  325 VNEPSIEDSITMLRGLKGRLEAYHG--VKIADSAIVYAVNSSKKYIS-NRRLPDVAIDLLDTACASVMIALEsEPQEILN 401
gi 18202342      --------------------------------------------------------------------------------
gi 15678312  176 TNSPRVAVMEIPLPDRAERHLYYST---TLASASIPSDQIDLLSNITeGLYMKDLENILSDVLEEIDENQ---------- 242
gi 15597921  170 TQALVLSHQARSRPAGEQRKPFFNS-----VLWVVEKEGDLPDWLLVdNPRLRHIPVSKPDQPARRALAPALlRGLGGAG 244
gi 12230885      --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  548 IERKIKALEEQIIEANLKGDy-------------------------------EKEAQLKIEKAKLEKekqellgkvggve 596
gi 15594714  437 ------------------------------------------------------IKRIITk------------------- 443
gi 15595179  401 ----------------------------------------------------LTKDNIIT-------------------- 408
gi 19552964  326 -----------------------------------------------------KQRLINNHVIAPSl------------- 339
gi 19552991  257 -------------------------------------------------------GKPMDMD------------------ 263
gi 19074942  402 QKSKAWGLDIAKTSLEFDLSqkkdeqtlkklkevveelekvkaslqpmeeayLRDKKHIIEAKKLKKkledtklrlaqae 481
gi 18202342    1 -----------------------------------------------------------------------mpeptptay 9
gi 15678312  243 ------E---------------------------------------------VSSSMLRKIVNRYR-------------- 257
gi 15597921  245 VAEEALQQAAATFVENTEG----------------------------------LLLLDLNAIVQLAR------------- 277
gi 12230885      --------------------------------------------------------------------------------
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  597 akiaelkkkieeldekikeaaekgdyekeaelkiekAKLEKELKKLEQeKske---lvVTWDDVAEVVSEWTGIPVS-RL 672
gi 15594714  444 -------------------------------------------------------------DDVCDLIKSIVGSNIF-NF 461
gi 15595179  409 -------------------------------------------------S-----------DDIQKAINEILSIKTA-NN 427
gi 19552964  340 ------------------------------------KFP------------------------VSERHIHNTARKLA-FG 358
gi 19552991  264 --------------------------------------------------------------LLGDVLHDAIGVDIA--- 278
gi 19074942  482 -----------------------rdrntyvaydlktNVIPVIESELKRlEles--vvvILPSHVAEIISRWTGIDVK-RL 535
gi 18202342   10 pvrldelinaikrvhsdvldqlsdavlaaehlgeiadhlighfvdqarrsgaswsdigksmgvtkqaaqkrfvpraeatt 89
gi 15678312  258 ---------------------------------------------------------------IGTEEDPWSRIPLT--G 272
gi 15597921  278 -----------------------------------------VEG--------------LAMERIADAVRRYKVGVTEdPW 302
gi 12230885    1 --------------------------------------MPFLSDMLDQsRrqqdeeqaLARENLAEASLLQAHLSHRsAL 42
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  673 KEEEMQKLLKLEDELHKRVVDQEHAVKAVAEAIRRARAGLKDPKRPIA-----SFLFLGPTGVGKTELSKALAELLFGDE 747
gi 15594714  462 EEYDGELLINLENRIKKELIIHDNLVLDLILNIKLLKFNLLANRSTIG-----IFAFIGASGSGKCKLMDILSEEFK--- 533
gi 15595179  428 TKEEILELKEIESEINKKVIGQKHAVSELIKEIIKVKLGLNDDSKPLT-----SILLIGSSGCGKTALTDEISKKIIKDQ 502
gi 19552964  359 SQVPASINTDDARDKLETLFGQDHIIEPVLTAIKREQLGIFPRTKPLS-----WVF-AGSSGVGKTEMARILSRAING-- 430
gi 19552991  279 ---FKVDGTSIKDKLDEKVMAQSLATTVVARRLQLVVADLHDKSRPLS-----NFLFTGPTGVGKTELVKQLARVLFGDD 350
gi 19074942  536 TIKENERLMEMSSRIKKRIFGQDHAVDAIVDSILQSRVGLDDDDRPVG-----SFLLLGPTGVGKTELAKAVAMELFDNE 610
gi 18202342   90 ldsnqgFRRFTPRARNAVVAAQNAAHGAASSEITPDHLLLGVLTDPAAla--tALLQQQEIDIATLRTAVTLPPAVTEPP 167
gi 15678312  273 --PPKGLLDSAENWFLERVVGQDHAVREIVNAIKKARSGVVGLSSGGQskpkaTFFFAGPTGVGKTFLAKKLAEYLFDTE 350
gi 15597921  303 LKIDRQRIRQADEIVRRRVKGQQHAVTHMLDIVKRAMTGVGASRKGNRpr--gVAFLAGPTGVGKTELAKTVTSLLFGDE 380
gi 12230885   43 RSRFRFDPAAVMDCLRAEVLGQDPALQAVEDMLKVVRADIADPRRPLF-----SALFLGPTGVGKTEIVRALARALHGDA 117
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  748 -DALIRLDMSEFKEEHSVAKLIGAPPGYVGYEE-GGKLTEAVRRK--P--YSVILLDEIEKAHPRVLDLFLQVLDDGRLT 821
gi 15594714  534 -IPKFSLNMGEYNDFNSLDRLIGPVLSNEGYYEsTRFFKFLNKSS-----NSIIFLSDFDKCNKRVLDFFLEGFKTGKLF 607
gi 15595179  503 -NSVLKLDMSDYKEENSISKLIGTNPGYVGYSD-GGILTNKLRHS--F--ETLILFENIENAHSSVLNLISRMLENGELI 576
gi 19552964  431 -GDPIIINGPEYISPESITGLIGSSDGYIGSNSkRAKPLDPLISN--P--RQVIVLDEFEKSHPHFQQLFMAALDTGTMA 505
gi 19552991  351 tGRLIRFDMSEFALESSLDLFRSELTRRVADQG-----------N-----A-IVLLDEVEKADRAIARLLLQVLDDGRLS 413
gi 19074942  611 -KDMLVIDMSEYGNEMGITKLIGANAGYVGYNQ-GGTLTEPIKGR--P--YNVILLDEVDLAHQTVLNTLYQLLDEGRVT 684
gi 18202342  168 -QPIPFSGPARKVLELTFREALRLGHNYIGTEHlLLALLELEDGD--G--PLHRSGVDKSRAEADLITTLASLTGANAAG 242
gi 15678312  351 -EAFLRFDMSEFKEEHTVSKLIGSPPGYVGYEQ-GGQLTNAIKNR--P--FSVILFDEIEKAHPKIMDIFLQILDDGRLT 424
gi 15597921  381 -SAYIRFDMSEFSAEHADQRLIGAPPGYVGYDV-GGELTNAIREK--P--FSVVLFDEIEKAHPRILDKFLQILDDGVLT 454
gi 12230885  118 -EGFCRVDMNTLSQEHYAAALTGAPPGYVGAKE-GTTLLEQDKLDgsPgrPGIVLFDELEKASPEVVHALLNVLDNGLLR 195
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  822 DSHG-RTVDFRNTVIIMTSNIGSQYLLNI---PVDad---------eeTLNREFEKAKEKVLEELKLYMRPEFINRIDE- 887
gi 15594714  608 DGLG-KKVSLSESLIVISINAESKELNSIg--------------------FRNKMAGENDFNFILKKRLPNEFLELIDH- 665
gi 15595179  577 DSKE-DKILFKNTIIIMTTNIGSRMLLGEkniGFNkn----------qQKSLETKSFKEEINQDLEKRFKLSFLDRIQK- 644
gi 19552964  506 MANG-TTLNFSQAIIIATTNAARDKIGRDsfgFDSdnsg-----vlgsAQAATDPRAQERLKSLMSKDFPVELLNRFQN- 578
gi 19552991  414 DDYN-REVSFLNTYIVMTTNAGSEIFETIsnyATDdt----------gDGRAIKDFVKNIHTSIKNKGFPPELLGRVDE- 481
gi 19074942  685 DGKG-AVVDFRNCVVIMTSNLGQEIIMRS-------------------R-GELNDDERKKIEEIVLNRFGAPFVNRIDE- 742
gi 18202342  243 ATDA-GATDAG--------------------------------------------------------------------- 252
gi 15678312  425 DSRG-QTVFFTESVIIFTSNIGTRTVDSRgntTSEqrkldeiindsdlSDSERERRVREHFTRSVREFFMHEISRRELLn 503
gi 15597921  455 SGRG-DRVYFSEALIVFTSNLGIYRQGENgerVANvlp-------gepFEAVQGKVHGEIERYFKLVLNRPEILNRIGEn 526
gi 12230885  196 VASGeRTYHFRNTLVFMTSNLCAHEIQRYderRQRlpwr-----llpvGGERRRRDIDGMVRARLLKTFSPEFVNRLDS- 269
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15606774  888 -----IIVFKPLTM-RELSKIIDLLIANVNKRLA----ERNIKIELTEEAKKELVRRGYD----PAFGARPLKRTIQKYV 953
gi 15594714  666 -----VFVFKSIDE-LDFEKIIFNELNYFARILR----DRKFDVFFEKSVVDYIREKIYG----KGYSLKSVRKFIFKEL 731
gi 15595179  645 -----KIILNILTK-ENVEEICKNYLNTLKTKFH----SKGIEIEIKKDVDKFITTKYYK----KNSGARSVIAAIKGKI 710
gi 19552964  579 -----IFAFNRIDA-GTYREILDNLYQRRRDAVLl--sHPHYAAQIPADIDSDTLDQLVEttfiSDFGARPAARTIEDHI 650
gi 19552991  482 -----IVPFQPLSE-TTQDRIISKKLQDVATEVYe---RHGVKLHCSQKVMEFLLVDQVEes-aESGGARGAVRSLQREV 551
gi 19074942  743 -----VLYFNNLDR-ENMHRILEYQMGYLEKKLR----GRGITFKVSDAVKEDMVTKVLS----SIYGARQLRRFIRSSF 808
gi 18202342      --------------------------------------------------------------------------------
gi 15678312  504 rigshIIAFNYLKKsDYQVNIIENKLKDISENFRdkfaGRGHRLHLSGELTGYFLEKYGDs--iSEFGGRGLVNALEDEI 581
gi 15597921  527 -----IIVFDFIRA-DVAEQIFTQMVNGTFADLR----EQRLVIELAEAPRQALHDLCLGd---LSNGGRGIRNQLEARL 593
gi 12230885  270 -----VVTFNWIER-DVVARLVELEVQRLNRRLE----KHRCRLEATPEVLAKIARAGFD----RQFGARALRRSVRHHL 335
                        970       980       990      1000
                 ....*....|....*....|....*....|....*....|.
gi 15606774  954 ETPLADKIIRGEIKd---GMTVVVDYKDG---EFVFIPKEE 988
gi 15594714  732 GKLLIDEILFKKIEn---SGKIKIYLD-E---TIKYEFL-- 763
gi 15595179  711 EENIITKIAENQNIn---KITIYLEKE-----KIIIE---- 739
gi 19552964  651 ASLLM------------------------------------ 655
gi 19552991  552 VTEVATFINTYPEVr---DIYVDVDGQMr--nKTNRVSTAR 587
gi 19074942  809 KRALTKVLLMRVNEd---PIEVSCTHPSegagGIRISDYVY 846
gi 18202342      -----------------------------------------
gi 15678312  582 GNIVADQLLLAEERgm-sDINFEVYVDG----DVIRCRRS- 616
gi 15597921  594 LNPLSRALFDQDAQp---GERFLISALD----ADGLTLERR 627
gi 12230885  336 EVPLAEHLLDHHQPgdgnCTTYLASLEHE---RVRFVRR-- 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap