Conserved Protein Domain Family
Ffh

?
COG0541: Ffh 
Signal recognition particle GTPase [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 223615
View PSSM: COG0541
Aligned: 66 rows
Threshold Bit Score: 525.175
Threshold Setting Gi: 19074175
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15889951  32 MFENLQDRLGSILN-GLTGRGALTEADVAAALREVRRALLEADVALEVVRSFTDRVREKAVGAAVLKSIKPGQMVVKIVH 110 Agrobacterium tumef...
12230645   1 ----MMEGVRRAVA-KFLRGGGVYEKAVDAFVKDLQRELIKADVNVKLVLNVTRRIKERALKEEPPPGVTRRDWMIKIVY 75  Aeropyrum pernix
19074175   1 MITELGRSITNTLSnLLSSPATD--QHIETAIREICNSLILSNVNPRYVSDLRDELRAKLDPGKMAPGFNKARMVQNAVY 78  Encephalitozoon cun...
20095048   1 MIG-FADRLAEITK-KIKGASIIDEDFVKEVVRDVQRALLEADVDVKLVLELSKRIEKRALEEEPPAGVPKRDYLLRIVY 78  Methanopyrus kandle...
3334341    1 MLGNLGRSLSKTMK-KLAGMTIVDEEVVREVIKDIQRALIQSDVNIKLVFNLSKSIEERALNEEPPKGITPKEHIISIVY 79  Methanothermobacter...
12230641   2 VLDSLGKALSNALK-KIARAGSVDEALVKEVVRDIQRALIQADVNVRLVLKLTKEIQRRALEEKPPAGISKKEHIIKIVY 80  Pyrococcus abyssi
18314019   1 -MKALTEIFGKLLE-KIRGVDYIDEATLQELSREIQRTLLKADVPLDLVKSFTENAVKRIKEEKPPAGIPPREYLIYVLY 78  Pyrobaculum aerophilum
14591457   4 VLDSLGRALSNALK-KIARAGSVDEALVKEVVRDIQRALLQADVNVRLVLKLTKEIQRRALEEKPPAGISKKEHIIKIVY 82  Pyrococcus horikoshii
134887     2 VFADLGRRLNSALG-DFSKATSVNEELVDTLLKNICTALLETDVNVRLVQELRSNIKKKINVSTLPQGINGKRIVQKAVF 80  fission yeast
21362961   1 ----MLENIRDAVR-KFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVY 75  Sulfolobus solfatar...
15889951 111 DELVEMLGt-EGVSIDLH-AAAPVVIMMVGLQGSGKTTTTGKIAKRLTDrDKKKVLMASLDTRRPAAQEQLRQLGVQTGV 188 Agrobacterium tumef...
12230645  76 EELVKLFG--GDQEPQVDpPKTPWIVLLVGVQGSGKTTTAGKLAYYYVR-RGYKVGLVSSDTHRPGAYEQLKRLAEEAGA 152 Aeropyrum pernix
19074175  79 ERLVDLLDp--RTESYKIeKGRTSVVVFVGLQGSGKTTSICKYANFYKK-KGYKVGIVCADTFRAGAFDQVRQNALKIKV 155 Encephalitozoon cun...
20095048  79 EELVELLGgeKTEGLDIDlSRDVNVIMLVGLYGMGKTTTAAKLARYLQR-KGYRVGLVGADPYRPAAGEQLRQLAEEVDV 157 Methanopyrus kandle...
3334341   80 DEMVKLLGe-KSHELVID--DKPYRILFLGLQGSGKTTTIGKLARYLRK-KGFTVGVVCTDTWRPAALEQLKQYTEGQDV 155 Methanothermobacter...
12230641  81 EELTKFLGt-EAKPIEIK--EKPTILLMVGVQGSGKTTTVAKLARHFQK-RGYKVGVVCSDTWRPGAYHQLKQLLDPYHI 156 Pyrococcus abyssi
18314019  79 EELVKLLG--GEQPAEFKpTKKPYIVLLLGVEGSGKTTTAAKLAKYLAK-RGYKVGLVETDTIRPAAFDQLRQLAEKIGV 155 Pyrobaculum aerophilum
14591457  83 EELTKFLGt-EAKPIEIK--EKPTVLLTVGVQGSGKTTTVAKLARYFQK-RGYKVGVVCSDTWRPGAYHQLKQLLDPYHI 158 Pyrococcus horikoshii
134887    81 DELCSLVDp--KVDAFTPkKGRPSVIMMVGLQGSGKTTTCSKLALHYQR-RGLKSCLVAADTFRAGAFDQLKQNAIKARV 157 fission yeast
21362961  76 DELSKLFG--GDKEPNVNpTKLPFIIMLVGVQGSGKTTTAGKLAYFYKK-RGYKVGLVAADVYRPAAYDQLLQLGNQIGV 152 Sulfolobus solfatar...
15889951 189 DTLPIiAGQSPTDIAARAVQAAKLGGHDVVILDTAGRTHI--DEPLMLEMADIKKKSNPHEILLVADSLTGQDAVNLARN 266 Agrobacterium tumef...
12230645 153 MFYGErEG-DPAEIARRGLEDLLSRGAEIVIVDTAGRHGHgeEARLLDEMKAIASKVRPDEVALVIDASIGQKAMGLAER 231 Aeropyrum pernix
19074175 156 PFFGS-SEADPVKVASAGVERFRKERFELILVDTSGRHTQ--ETELFTEMKDIIREISPSSIVFVMDAGIGQSAEDQAMG 232 Encephalitozoon cun...
20095048 158 PVHVEd-VDDAVEMAVKGVEALKDEC-DVVIVDTAGRDRL--SEDLIDELREMAERIEPHEVLLVLDATVGQKAGDHAEA 233 Methanopyrus kandle...
3334341  156 SIYGDpQNRDALDLAEKGLARFQKK--DVIIFDTAGRHKE--EKDLLREMEELSAIVEPHEAILVIDGTIGQQAREQALA 231 Methanothermobacter...
12230641 157 EVFGDpNEKDAIKLAKEGVEHFKAKGVDLIIVDTAGRHKE--EKDLIEEMRMISNEIKPHEVILVIDGTIGQQAYNQALA 234 Pyrococcus abyssi
18314019 156 PFYGErDGKDAVEIAKRGVQNFKN--MDVIIVDTAGRHRN--EEALLKEVRAIYDAVSPDEVVLVIDATVGKMAAAQAEA 231 Pyrobaculum aerophilum
14591457 159 EVFGDpNEKDAVKLAKEGVEYFKTRDVDLIIVDTAGRHKE--EKDLIEEMRMISEEIRPHEVILVIDGTIGQQAYNQALA 236 Pyrococcus horikoshii
134887   158 PYFGSyTETDPVVIAKEGVDKFKNDRFDVIIVDTSGRHQQ--EQELFAEMVEISDAIRPDQTIMILDASIGQAAESQSKA 235 fission yeast
21362961 153 QVYGEpNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYgeETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASR 232 Sulfolobus solfatar...
15889951 267 FDERVGITGLVLTRMDGDGRGGAALSMRAVTGKPIKLIGIGERMNELDEFHPRRIADRILGMGDIVSLVEKAAENIDA-E 345 Agrobacterium tumef...
12230645 232 FHKSTPIGSIIVTKMDGTARGGGALTAAAVTGARIKFIGTGETLGELEPFAPRRFVARILGMGDLESLLERIKSLEEAg- 310 Aeropyrum pernix
19074175 233 FKRAVDVGSIILTKIDGTTKAGGAISSVAATKCPIEFVGTGEGMDDLEAFDARRFVSRMLGMGDVEGLMEKVGSLG---I 309 Encephalitozoon cun...
20095048 234 FHEAVQLTGVVITKLDTAAKGGGALSAVARTGAPIKFVGTGERVDDLEEFNPRSFVARLLGIGDIDELLRRTEEMLEE-- 311 Methanopyrus kandle...
3334341  232 FRKATDIGSIIVTKLDGSAKGGGALSAVAEIGAPIKFIGTGERIDDLEVFDPERFISRLLGMGDLRSLLEKVEEVSEE-E 310 Methanothermobacter...
12230641 235 FKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGTGEKIDDLEPFDPARFVSRLLGLGDIQGLLEKFKELEKEvE 314 Pyrococcus abyssi
18314019 232 FMKYLPIHSVIITKMDSTARGGGALAAVAKTGAKVKFIGVGEDVDEFEQFSPRKFVARVLGMGDLDTLLEKIKAVFEE-- 309 Pyrobaculum aerophilum
14591457 237 FKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGVGEKIDDLEPFDPARFVSRLLGLGDIQGLLEKFKELEKEvE 316 Pyrococcus horikoshii
134887   236 FKETADFGAVIITKLDGHAKGGGALSAVAATKTPIVFIGTGEHINDLERFSPRSFISKLLGLGDLEGLMEHVQSLD---F 312 fission yeast
21362961 233 FHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLEEYd- 311 Sulfolobus solfatar...
15889951 346 KARSMAEKMAKGK--FDLNDLADQLGQMKKMGGMGGIMGLMPGMAg--MKDKMASAGMNDKMFDRQIAIISSMTKAERAN 421 Agrobacterium tumef...
12230645 311 ELDRAAEDVLKGr--ITMRTIYRQLRAMRKLGPLGKVLQMLPG-AsmlASIDEGALKLGEEKMKRWMAIIESMTYEELDR 387 Aeropyrum pernix
19074175 310 DEKEVVKKLRQGR--FTLGDFYDQFQKILSLGPISKLLEMIPGFSg--LS--LPDEDT----FKKLIYVFDSLSRGELDS 379 Encephalitozoon cun...
20095048 312 --EEKAEDVLEGe--FTLKDLYEQLEALSKMGPVDKLLQYVPGMGg--gRNVRKISQITEERLKKYKVIMDSMTEKELEN 385 Methanopyrus kandle...
3334341  311 IAEESLDAILSGk--FTLRDMRVQFEMMGKMGPLQQVMSMLPGAG----KLPKDASRMTEETIRKYLIIMDSMTEEELEK 384 Methanothermobacter...
12230641 315 FTEEDLERFLKGk--FTLKDMYAQLEAMRKMGPLKQILRMIPGLGy---SLPDEVISVGEERLRKFKVIMDSMTEEELMN 389 Pyrococcus abyssi
18314019 310 --EEVLEEIESGr--LDLLTFKKQIDSLLKLGPLSKVFQLLPGnl--aAKISEEQIELSQRNLKKWRAILSSMTLEELKN 383 Pyrobaculum aerophilum
14591457 317 FTEEDIDRFLRGk--FTLKDMYAQLEAMRKMGPLKQILRMIPGLGy---SLPDELISVGEERLRKFKVIMDSMTEEELMN 391 Pyrococcus horikoshii
134887   313 DKKNMVKNLEQGK--FTVRDFRDQLGNIMKLGPLSKMASMIPGMSn--MMNGMNDEEGS-LRMKRMLYIVDSMTEQELDS 387 fission yeast
21362961 312 KIQKKMEDVMEGKgkLTLRDVYAQIIALRKMGPLSKVLQHIPGLGimlPTPSEDQLKIGEEKIRRWLAALNSMTYKELEN 391 Sulfolobus solfatar...
15889951 422 PDILK---HSRKKRIAAGSGTDAAEINKLLKMHRGMADMMKAMGG-------KGKGG-I--M------KQMMGGlag--- 479 Agrobacterium tumef...
12230645 388 PEIID---KRRMRRIAIGSGTSVDDVRELLVYYKNLKTMMKKLKRd------kRLLRrLgmEl----------------- 441 Aeropyrum pernix
19074175 380 TGQVFekePSRIMRVARGSGTSVQGVVEILTQFKKAHAVMQKISs------iPGIEGmMg---------NPSSMslaq-- 442 Encephalitozoon cun...
20095048 386 PEILN---KSRIRRIAIGSGTSERDVIELLNHYRMMKDVIEDIQSgriprigGELGRvIrnVlrg--------------- 447 Methanopyrus kandle...
3334341  385 PDIIK---HSRIRRIARGSGTRNEDVKELLKYYRVTKKAMKGLGRrk---mgGPMGQlMrqFmr---------------- 442 Methanothermobacter...
12230641 390 PDIIN---YSRIKRIARGSGTSVKDVKELLNQYNQMKKFFKSMNKr-------QLLRlArrFgm---------------- 443 Pyrococcus abyssi
18314019 384 PEILN---ASRIRRIALGAGVAPKDVKEMLTVYENLRKMSKTLRRq---------lRlRmaK------------------ 433 Pyrobaculum aerophilum
14591457 392 PEIIN---YSRIKRIARGSGTSIKDVKELLTQYNQMKKFFKSMNKr-------QLSRlArrFgm---------------- 445 Pyrococcus horikoshii
134887   388 DGLLFveqPSRVLRVARGSGTSVLEVEETISQVRVFAQMAKKIGg------kDGILGkLggNpaaalkKDPRQLaamqkr 461 fission yeast
21362961 392 PNIID---KSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMVKRrr-----gNIDKlFggKig---------------- 447 Sulfolobus solfatar...
15889951 480 ------kmGLGG 485 Agrobacterium tumefaciens str. C58 (Cereon)
12230645     ------------ Aeropyrum pernix
19074175 443 ----kaklKEQA 450 Encephalitozoon cuniculi
20095048     ------------ Methanopyrus kandleri AV19
3334341      ------------ Methanothermobacter thermautotrophicus
12230641     ------------ Pyrococcus abyssi
18314019     ------------ Pyrobaculum aerophilum
14591457     ------------ Pyrococcus horikoshii
134887   462 mqamgmggGMPG 473 fission yeast
21362961     ------------ Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap