Conserved Protein Domain Family
SpoVK

?
COG0464: SpoVK 
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms]
Statistics
?
PSSM-Id: 223540
View PSSM: COG0464
Aligned: 107 rows
Threshold Bit Score: 60.2224
Threshold Setting Gi: 7388514
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   430 ALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAAScssdeRKITfFMRKGADILSKWVGEAERQLRLLFEEAKK 509
gi 15827806  170 fpegkqwrhpdlkaagaamatsalaslgvfeeafrrgkeaiegdrvpraanialytqgmclrhvgredeavellrrvysr 249
gi 7388389   198 ltpmvndpdldeafshaakitlgtalarlgmfapalsyleepdgpvavaavdgalakalvlrahvdeesasevlqdlyaa 277
gi 7388514   170 fpeatqwrhpelkaagaamattalaslgvfeeafrraqeaiegdrvpgaanialytqgmclrhvgreeeavellrrvysr 249
gi 7388514   170 fpeatqwrhpelkaagaamattalaslgvfeeafrraqeaiegdrvpgaanialytqgmclrhvgreeeavellrrvysr 249
gi 7388381   186 ahaaahlgqgrvaldwldrvdvighsrsserfgadvltaaigpadipllvadlayvrgmvyrqlheedkaqiwlskatin 265
gi 7388381   186 ahaaahlgqgrvaldwldrvdvighsrsserfgadvltaaigpadipllvadlayvrgmvyrqlheedkaqiwlskatin 265
gi 16263937      --------------------------------------------------------------------------------
gi 15966148  123 PLTGEDAAHFKALLSASAYIAAFTLAAYLGATLQGEGEPVDd----AAEPdFLFDTPQDALKTMVAGLDRSIAGAPDELA 198
gi 13472456  121 PLEGDEASAFKKLLSASAYISAFSLASYLFQLIDSDGEAPNd----IPEPdFLFDTPQDAVKSILAGLDKAIAGSKDDAD 196
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   510 HQP-----SIIFFDEIDGLAPVRSS---KQEQIHASIVSTLLALMDGMDn---RGQvIVIG-ATNRPDAVDPALRRPGRF 577
gi 15827806  250 dakftparealdnnnfrltltdpetieartdpwdpdsaptraqteaaryariaakylaegdaelnamLGMEQAKREIKLI 329
gi 7388389   278 hpeneqveqalsdtsfgivtttagrieartdpwdpatepgaedfvdpaaherkaallheaelqlaefIGLDEVKRQVSRL 357
gi 7388514   250 dakftparealdnpnfrliltdpetieartdpwdpdsaPTRAQTEAARHaemaAKYlAEGDaELNAMLGMEQAKKEIKLI 329
gi 7388514   250 dakftparealdnpnfrliltdpetieartdpwdpdsaptraqteaarhaemaakylaegdaelnamLGMEQAKKEIKLI 329
gi 7388381   266 gvltdaakealadpnlrlivtdertiasrsdrwdastaksrdqldddnaaqrrgellaegrellakqVGLAAVKQAVSAL 345
gi 7388381   266 gvltdaakealadpnlrlivtdertiasrsdrwdastaksrdqldddnaaqrrgellaegrellakqVGLAAVKQAVSAL 345
gi 16263937    1 ----------MLMPDAPSNTESLPT---SVDLAGEYQASGVAEILDELD---------------RELVGLKPVKQRIRET 52
gi 15966148  199 LVArarafSRIAIEGLIARKARFTGlqnFESVHIRLDQDDFTLNGFDVApgqkRKPlVMTFkKPEEIIGNHIAKYQALKL 278
gi 13472456  197 LATrarafARVAIDGLLARKGRFDGigpFENAHIRIDADDFTLDGFDVApgkrSKPlVMTFkKPEEVVGNHIAKYQSVKL 276
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   578 DREFYFPLPDVKARFKILQIQTRKWSSPLs-TNFIDKLAFLTKGYGGADLRSLCTEAALISIQRSfpqiyrsndkllvdp 656
gi 15827806  330 KSTTRVNLARAKMGLPVPVTSRHTLLLGP--PGTGKTSVARAFTKQLCGLTVLR-KPLVVETSRT--------------- 391
gi 7388389   358 KSSVAMELVRKQRGLTVAQRTHHLVFAGP--PGTGKTTIARVVAKIYCGLGLLK-RENIREVHRA--------------- 419
gi 7388514   330 KSTTKVNLARAKMGLPVPVTSRHTLLLGP--PGTGKTSVARAFTKQLCGLTVLR-KPLVVETSRT--------------- 391
gi 7388514   330 KSTTKVNLARAKMGLPVPVTSRHTLLLGP--PGTGKTSVARAFTKQLCGLTVLR-KPLVVETSRT--------------- 391
gi 7388381   346 EDQLEVRMMRLEHGLPVEGQTNHMLLVGP--PGTGKTTTAEALGKIYAGMGIVR-HPEIREVRRS--------------- 407
gi 7388381   346 EDQLEVRMMRLEHGLPVEGQTNHMLLVGP--PGTGKTTTAEALGKIYAGMGIVR-HPEIREVRRS--------------- 407
gi 16263937   53 AALLLVERARRAMGLSHEPPSLHMSFTGN--PGTGKTTVALRMANLLHRLGYIR-KGHLVSVTRD--------------- 114
gi 15966148  279 AKMLMAYDFDRQMNPFVELGGFLFTFIGDgmPGTGKTILIQMLAGMLHEYCGIAGYPFHYENFGV--------------- 343
gi 13472456  277 AKMLMAYDFERELNPFVELGGFLFTFIGDgaPGTGKTTLIQMIAGLVNGYCQVAGYPFAYENFGV--------------- 341
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   657 skikvkvsdfmlalkkivpssarstgsspQPLPELIKPLLADQLNNLKNKLDYmlnikdttfqRNTSLLQNFIDYEEYSG 736
gi 15827806  392 -----------------------------KLLGRHMADAEKNTEEMLEGALG------------GAVFFDEMHTLHEKG- 429
gi 7388389   420 -----------------------------DLIGQHIGETEAKTNAIIDSALD------------GVLFLDEAYALVAT-- 456
gi 7388514   392 -----------------------------KLLGRYMADAEKNTEEMLEGALG------------GAVFFDEMHTLHEKG- 429
gi 7388514   392 -----------------------------KLLGRYMADAEKNTEEMLEGALG------------GAVFFDEMHTLHEKG- 429
gi 7388381   408 -----------------------------DFCGHYIGESGPKTNELIEKSLG------------RIIFMDEFYSLIERHQ 446
gi 7388381   408 -----------------------------DFCGHYIGESGPKTNELIEKSLG------------RIIFMDEFYSLIERHQ 446
gi 16263937  115 -----------------------------DLVGQYIGHTAPKTKEILKKAMG------------GVLFIDEAYYLYRP-- 151
gi 15966148  344 -----------------------------DQISSYQGKSGQNCKEFVNNVVNPr--------aIGFGTIDDVDQVAAKRS 386
gi 13472456  342 -----------------------------DQISSYQGKSGQNCRQFINNVLNPr--------aIGFGTIDDIDQVAARRS 384
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   737 EEEEHDKYGGNEDTSSFRSYEFFEsmaESQICKPRLLINGPKGNGQQYVGAAILNylEEFNVQNLDLaSLVSESSRTIEA 816
gi 15827806  430 YTRGDPYGNAIINTLLLYME--------NHRDELVVFGAGYAKAMDKMLEVNQGL--RRRFSTVIEFfSYTPEELIALTQ 499
gi 7388389   457 -GAKNDFGLVAIDTLLARME--------NDRDRLVVIIAGYRADLDKFLDTNEGL--RSRFTRNIDFpSYTSHELVEIAH 525
gi 7388514   430 YSQGDPYGNAIINTLLLYME--------NHRDELVVFGAGYAKAMEKMLEVNQGL--RRRFSTVIEFfSYTPQELIALTQ 499
gi 7388514   430 YSQGDPYGNAIINTLLLYME--------NHRDELVVFGAGYAKAMEKMLEVNQGL--RRRFSTVIEFfSYTPQELIALTQ 499
gi 7388381   447 DGTPDMIGMEAVNQLLVQLE--------THRFDFCFIGAGYEDQVDEFLTVNPGL--AGRFNRKLRFeSYSPVEIVEIGH 516
gi 7388381   447 DGTPDMIGMEAVNQLLVQLE--------THRFDFCFIGAGYEDQVDEFLTVNPGL--AGRFNRKLRFeSYSPVEIVEIGH 516
gi 16263937  152 -DNERDYGQEAIEILLQVME--------NNRDDLVVILAGYADRMDRFFESNPGF--RSRIAHHIDFpDYDNGELLSIAE 220
gi 15966148  387 DDRASAGQHEVTAVLMESFAGAST---VVRGNCTFGMFSNYPENVDDALRQRAGA--RWLVDGPQTEdDYIDIFALLVGK 461
gi 13472456  385 DDRASAGQQEITGVLMDAFAGAGT---VVRGNCSFGMFSNYPENVDDALRQRAGA--RWLVDGPQTRdDYIDIFVLLAGK 459
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   817 AVVQSFMEAKKRQPSVVFIPNLDIWINTIPENVILVLsglfrslqsnEKILLLCLAENLDISEVKNgilsdfafdknifq 896
gi 15827806  500 LMGQENEDVITEQEAQVLLPSYTKFYLDETYSEDGDLir-------gIDMLGNAGFVRNVVEKARD-------------- 558
gi 7388389   526 KMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISrr-------sLDIAGNGRFVRNIVERSEE-------------- 584
gi 7388514   500 LMGRENEDVITEEESQVLLPSYTKFYMEQSYSEDGDLir-------gIDLLGNAGFVRNVVEKARD-------------- 558
gi 7388514   500 LMGRENEDVITEEESQVLLPSYTKFYMEQSYSEDGDLir-------gIDLLGNAGFVRNVVEKARD-------------- 558
gi 7388381   517 RYATPRASQLDDAAREVFLDAVTTIRNYTTPS----Gqh-------gIDAMQNGRFARNVIERAEG-------------- 571
gi 7388381   517 RYATPRASQLDDAAREVFLDAVTTIRNYTTPS----Gqh-------gIDAMQNGRFARNVIERAEG-------------- 571
gi 16263937  221 SMLSRQGYRFDSKASAVMSDYIARRRRQPHFAN--------------ARSIRNALDRAR-LRQANR-------------- 271
gi 15966148  462 NHQIPLGEHDLYAGQEIKRAVSQSYAAHARPQEEGLAav-------wERYQKEKGKIATLADVGAY-------------- 520
gi 13472456  460 NHEIPLGRHELYAAQEIQRAVEEAYEEHEKPQEDGLMkv-------yERYMKENGAPKTMADIGTY-------------- 518
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   897 lhkpskenitryfsnliellktkpsdipmkkrrvkplpeLQKVTSNAAPTNFDEngeplsekVVLRRklksfqhqdMRLK 976
gi 15827806  559 ---------------------------------------HRSFRLDDEDLDAVL--------ASDLTqf-----saEQLL 586
gi 7388389   585 ---------------------------------------EREFRLDHSEHAGSG--------E-------------FSDE 604
gi 7388514   559 ---------------------------------------HRSFRLDDEDLDAVL--------ASDLTef-----seDQLR 586
gi 7388514   559 ---------------------------------------HRSFRLDDEDLDAVL--------ASDLTef-----seDQLR 586
gi 7388381   572 ---------------------------------------FRDTRVVAQKRAGQP----------------------VSVQ 590
gi 7388381   572 ---------------------------------------FRDTRVVAQKRAGQP----------------------VSVQ 590
gi 16263937  272 -----------------------------------------LFEESAGPVDAE------------------------Q-- 284
gi 15966148  521 ---------------------------------------LHMIKEAEPRFTGRA--------IRNit-------daVKLR 546
gi 13472456  519 ---------------------------------------LHLIKDAEPRFTGRA--------IKNvt-------daIKMR 544
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1729862   977 NVLKIKLSGLMDLFKNRYKRFRKPPIDdaflvhlfepetsndpnwqpayiKDENMILEVSTGrkffnmdldiVEERlwng 1056
gi 15827806  587 RFKELTSADLTEGLSAAVAERKSS-------------------------------------------------------- 610
gi 7388389   605 ELMTITADDVGRSVEPLLRGLGLSVRA----------------------------------------------------- 631
gi 7388514   587 RFKELTREDLAEGLRAAVAEKKTK-------------------------------------------------------- 610
gi 7388514   587 RFKELTREDLAEGLRAAVAEKKTK-------------------------------------------------------- 610
gi 7388381   591 DLQIITATDIDAAIRSVCSDNRDMAAIvw--------------------------------------------------- 619
gi 7388381   591 DLQIITATDIDAAIRSVCSDNRDMAAIvw--------------------------------------------------- 619
gi 16263937  285 -LSTITARDIAASRVFATVEPSHTETSp---------------------------------------------------- 311
gi 15966148  547 AMDVELPDDWFKDAGSFMHRPYDEKKAmiee---------------lrgpITIDMVLQEINRyadsefrytdKSDDaavg 611
gi 13472456  545 AMDIELPDDWFEKPEAFMHKTYDEKKAmiee---------------lrgpFSMDMVMQEINRyadsefrysdKSDDaave 609
                        650       660
                 ....*....|....*....|....*..
gi 1729862  1057 yysepkQFLKDIELIYRDANTIGDRER 1083
gi 15827806      ---------------------------
gi 7388389       ---------------------------
gi 7388514       ---------------------------
gi 7388514       ---------------------------
gi 7388381       ---------------------------
gi 7388381       ---------------------------
gi 16263937      ---------------------------
gi 15966148  612 eiirreRQRERAVREIETMKREGRWQG 638
gi 13472456  610 kllrdaRLRERAAREMEEMKKKGNWNA 636
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap