Conserved Protein Domain Family
DppD

?
COG0444: DppD 
ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism, Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 223521
View PSSM: COG0444
Aligned: 163 rows
Threshold Bit Score: 140.402
Threshold Setting Gi: 16263201
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283   4 ILSLSNLRTQFDTDRG----AVKAVDGVDLDISDGETVGLVGESGSGKSVTALSAMQLVDdP-GDVVGGGVTITDPDiaa 78
gi 14521146   3 LLDVRNLRVYYRTPVG----YVRAVDGVSFEVGEGEVFGVAGESGCGKSTLVHSLIL-RK-PpMEYKGGSAIFKGRd--- 73
gi 14521737   3 LLDVRNLRVYYRTPVG----YVRAVDGVSFEVGEGEVFGVAGESGCGKSTLVHSLIL-RK-PpMEYKGGSAIFKGRd--- 73
gi 14590411   3 LLRVRNLRIYYSTPRG----FVKAVDGVSFEVKKGEVFGIAGESGCGKSTLVHSLIL-RK-PpMTHKGGKAIFKGKd--- 73
gi 15642803   5 LLKAENVRAYYKLEKV----SVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMV-KpLTLVDGKIFLRVNGef- 78
gi 15642849   4 LRT-ENLKSYYILDIFgkkrVVKAVDDVNISIMENEIYGIAGESGCGKSTLLRALFAAIE-PpQRIVGGKVLYRENGke- 80
gi 15643072   4 IAVAENLRAYYFIKSGdkttSIRAVDNVSLHFFENEVYGIAGESGCGKSTLLKVLFGEIK-PpLKLVDGEVVFKLDGee- 81
gi 15643950   4 LISGKNLKAYYVLDLWgskkVVKAVDNVSLDILPNEIYGIAGESGCGKSTLLKALLALLD-PpLRLMDGELLYNIEGrp- 81
gi 15643976   8 VLDVRDLRIYYRTLYG----YVKAVDGVSFDIKRGEILGIAGESGCGKSTLGNGLIL-LK-PpMKYMGGEAILDGKn--- 78
gi 16082313   1 ---------------------------MNLRVRKGIILGIAGESGSGKSTLAQAIYRSLK-YpGEITSGQVYLDDQd--- 49
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283  79 rvlaahadaaatypfavvsacrelaadlcgddavdaaprelrgiaadleadpggigprlhefadridasgpdddtraigd 158
gi 14521146     --------------------------------------------------------------------------------
gi 14521737     --------------------------------------------------------------------------------
gi 14590411     --------------------------------------------------------------------------------
gi 15642803     --------------------------------------------------------------------------------
gi 15642849     --------------------------------------------------------------------------------
gi 15643072     --------------------------------------------------------------------------------
gi 15643950     --------------------------------------------------------------------------------
gi 15643976     --------------------------------------------------------------------------------
gi 16082313     --------------------------------------------------------------------------------
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283 159 eldaavldaldgfvfftaatvdtddpdvdasadpldvlrdrpdgaahvrltdarvdLTAAPER--AMrDLRGGEMGMIFQ 236
gi 14521146  74 --------------------------------------------------------LMSLPRDelR--KIQYSELSIIPQ 95
gi 14521737  74 --------------------------------------------------------LMSLPRDelR--KIQYSELSIIPQ 95
gi 14590411  74 --------------------------------------------------------LMKLSREeaR--KIQYKELSIIPQ 95
gi 15642803  79 ------------------------------------------------------veLSSMTRDevKR-KFWGKEITIIPQ 103
gi 15642849  81 ------------------------------------------------------vdVYSLSDEerR--RLRWSFISYVPQ 104
gi 15643072  82 ------------------------------------------------------yrINSMSLDqlK--KIRWKYVSYVPQ 105
gi 15643950  82 ------------------------------------------------------tnVTLLKSEtiR--KLRWSFISYIPQ 105
gi 15643976  79 --------------------------------------------------------IMALSPKelR--KVRYEKISIIPQ 100
gi 16082313  50 --------------------------------------------------------ILRINGEdlR--RIRATRFSFIPQ 71
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283 237 DPMTSLNPSLTVGEQVAESLRLHRYgeqptdswlnglraaisrgdTDEQVVADVVDVLDAVGIPEPetRLDEYPHEFSGG 316
gi 14521146  96 YAMNALNPTKRIKDIVWDLAREHGYa------------------dRR-EVEELLRERLSMVKLSPR--VADMYPVELSGG 154
gi 14521737  96 YAMNALNPTKRIKDIVWDLAREHGYa------------------dRR-EVEELLRERLSMVKLSPR--VADMYPVELSGG 154
gi 14590411  96 YAMNALNPTKKIKDIVWDLAREHGMq------------------dKK-EVEKLLKERLSMVKLSPK--VAEMYPVELSGG 154
gi 15642803 104 AAMNALMPTIRMEKYVRHLAESHGId------------------eEE--LLDKARRRFEEVGLDPL--WIKRYPFELSGG 161
gi 15642849 105 GSMSVLNPVVKIKETFKDFIESHTTg------------------kTKEEAYEMAKEHIKELGLPIE--ILNAYPHQLSGG 164
gi 15643072 106 GSMSVLNPVRKIRRIFLDVIEEHTSm------------------sRE-EAFSRIESYFEALGLPVR--VLDSYPHQLSGG 164
gi 15643950 106 GSMHVLNPVKRVRDTFIEILSSHVKk------------------qTK-EFLDLAVQHLKDLGLPER--VLNMFPHQLSGG 164
gi 15643976 101 YAMDAMNPTKKIKQIIDDLLHEHGEs------------------fER--KKDVIEERLEIVNLGKK--VLNMYPIELSGG 158
gi 16082313  72 AAMNALNPVKRIRYQFYDLLIAHGLq------------------pEK--NEDRIQAAIKMVRLREN--VLESFPHELSGG 129
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283 317 MRQRVLIAIALACRPRLLIADEPTTALDVTIQAQILDRISDLQD-EFGMSVLFITHDLGVVAETCDRVAVMYAGEIVEEG 395
gi 14521146 155 MRQRATMVVSTLLNPDLLIADEITSALDVTTQRVVIELLHHFMQeGIVKSIIFVTHDLALLRQIADRVMVMYAGKVVEIG 234
gi 14521737 155 MRQRATMVVSTLLNPDLLIADEITSALDVTTQRVVIELLHHFMQeGIVKSIIFVTHDLALLRQIADRVMVMYAGKVVEIG 234
gi 14590411 155 MRQRATMVVSTLLNPDLLIADEVTSALDVTTQRVVIELLHHFMEeGIVKSIIFVTHDLALLRQIADRVMIMYAGKVVEIG 234
gi 15642803 162 MRQRAVIAIATILNPSLLIADEPTSALDVVNQKVLLKVLMQMKRqGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFA 241
gi 15642849 165 MRQRVTIALATVLSPKVIIADEPTTALDVVTQRGVVQLLKEIQSs-RQNTIILVTHDMGVHANVTDRIAIMYAGKIIEEG 243
gi 15643072 165 MRQRVTIALATVLNPKVIFADEPTTALDVVVQRGVIQLLKKIHKe-QKNTLVIVTHDMGVHAHLATRIGVMYAGRLIEEA 243
gi 15643950 165 MRQRVTIALATVLKPRVIFADEPTTALDVVAQRAVMQLIRKIQNd-LKNTVVLVTHDMGVHAQITTRMAIMYAGKIVEEG 243
gi 15643976 159 MKQRMVMVISTLMNPDVLIADEITSALDVSSQRSVIQMLYEMREkEIMGSLAFITHDLSVLYQIADKVMVLYAGRVAEIS 238
gi 16082313 130 MRQRVVIAMSLLLRPDLVILDEPTTGLDVLVQHEILKDLKAIQRq-SGLTMIFITHDLSILYEIADEIAMIYAGEIVEFG 208
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15791283 396 PVEEIFHNPSHPYTYALLESIPRdd-----aDRLHPIEGNV-PDLIDLPSGCHFEARCPWASDaCVGDDIPYmEHgPDDV 469
gi 14521146 235 PMEEVLENPAHPYTQLLLNSLPRmgvh-ykrERLSGIPGYP-ISLLNPPKGCRFYTRCPFAME-DCRDVEPK-LV-KVGR 309
gi 14521737 235 PMEEVLENPAHPYTQLLLNSLPRmgvh-ykrERLSGIPGYP-ISLLNPPRGCRFYTRCPFAME-HCPEVEPK-LV-KVGK 309
gi 14590411 235 SMEEVLESPAHPYTQLLLNSLPRmgvh-ykrERLRGIPGYP-ISLLNPPEGCRFYTRCPYAMQ-VCREVEPE-LV-EVSP 309
gi 15642803 242 PVESLLEKPLHPYTQGLFNSVLTpepe-vkkRGITTIPGAP-PNLINPPSGCRFHPRCPHAMD-VCKEKEPP-LT-EIEP 316
gi 15642849 244 KTEEIFENPMHPYTKYLIYSLPKfg----dkGRRESAPGSP-PSLADLPPGCSFHPRCPHAFD-RCKKEVPP-LK-EYLP 315
gi 15643072 244 ETHEIFKNPLHPYTRFLINSLPRfg----drSRKEGTPGSP-PSLANLPSGCPFHPRCPIADQ-ICMEMEPD-LI-EVAR 315
gi 15643950 244 PTLEIFKNPLHPYTRYLIQSLPAig----dkKLRSGIPGSP-PSLVAPPPGCRFHPRCPHASQ-RCREEEPL-LK-EIKP 315
gi 15643976 239 PMEDIIQEPLHPYTKMLLSSLPKigvr-ysqTKLKGIPGYP-PSLLNIGPGCRFRDRCPYAFE-KC-EQDPP-VF-DVD- 311
gi 16082313 209 PRDEMLNDPQHPYNFLLLRSMPRigakrgtgYRLIGNPGNFrEDFN----GCQFYTRCPFSVP-QCVSKHPE-LT-SDDG 281
                       490
                ....*....|
gi 15791283 470 SHRSKCVEES 479
gi 14521146 310 DHYAACHLLG 319
gi 14521737 310 EHYAACHLLG 319
gi 14590411 310 GHYAACHLLG 319
gi 15642803 317 GRRVACWLYM 326
gi 15642849 316 GHRVACWLVE 325
gi 15643072 316 NHKVACWKVG 325
gi 15643950 316 GHKVACFLMe 325
gi 15643976 312 GRKVSCWLFE 321
gi 16082313 282 RHFRRCLRYP 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap