1GPJ


Conserved Protein Domain Family
HemA

?
COG0373: HemA 
Glutamyl-tRNA reductase [Coenzyme transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 223450
View PSSM: COG0373
Aligned: 42 rows
Threshold Bit Score: 296.466
Threshold Setting Gi: 7387744
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GPJ_A     2 EDLVSVGITHKEAEVEELEKARFESDEAVRDI---VESFG-LSGSVLLQTSNRVEVYASGA-------RDRAEELGDL-- 68  Methanopyrus kandleri
7387744    3 DRLAMIGVNVKTASREHVARLEKEWEKHLDTIg------YaSRGTVIIATCNRFEVYld-------spSRLVEDLASSia 69  Aeropyrum pernix
20138297   1 --MIQLLALKRDLKVEIREKFSIIEKRIGDKD---VLLKEvCNEVVILSTCNRIEIYFNsEknr-kqiIEEIFSKMGWni 74  Clostridium acetobu...
7387749    1 MVLGVVGISYREAALKERERAIQYLQSFEKNLflaQRFLGkGGAFIPLLTCHRAELYyys------esPEIAQAALLSel 74  Chlamydophila pneum...
19703981   5 ENIIVIGVSHENLSLLERENFMRTRPKYIIER---LYTEKkINAYINLSTCLRTEFYie-------lnSNIKAKEIKNl- 73  Fusobacterium nucle...
20138246   5 APLAAVILTYREVDADTLGRVGEEMKKCIEILg-------vKRPMFVLHTCGRVEAYly-------naSEEEINSVTLry 70  Pyrobaculum aerophilum
20138300   9 QNYCSILFTYKTIGISNLHLYYFRETEIKSLK------QLiNAEFAILQTCNRVEIYlysdtntlkevNKIIQYLNNIhn 82  Sulfolobus solfatar...
13541421   1 MNIVTLISWDFKRNNESFQRAIINGYDYWSRI----LDDHgVEKYVILLTCNRVELYYRg--------DPFDVQEKG--- 65  Thermoplasma volcanium
13878528   1 MQILTLISWDFKRNNNFFNQAVLNPYEYWADI----LEKNgISRYVILLTCNRVEIYLRAg-------FPEDLEAMK--- 66  Thermoplasma acidop...
20138346   6 GVVSGVRVSHETASLDELAAASAASTEAALDA---LLEQPpVEEAFVLQTCHRVEAYvvt-----adqASGRRALGGAgf 77  Halobacterium sp. N...
1GPJ_A    69 --IHDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRISEG 146 Methanopyrus kandleri
7387744   70 spGGEGLVRLQGIDAARHLFRVASGLESQIIGDHEVLGQVRRAWLKSREKGFTTPLLDEVFHRALKTGARVRSESAISSG 149 Aeropyrum pernix
20138297  75 -nFLENFFYCKGDEAINHLMEVACGFDSLILGEDQILGQIKAAYDTALKNKTSGSELKKLFQLVITCGKEFRSISMLNRI 153 Clostridium acetobu...
7387749   75 tsQGIRPYRHRGLSCFTHLFQVTSGIDSLIFGETEIQGQVKRAYLKGSKERELPFDLHFLFQKALKEGKEYRSRIGFPDH 154 Chlamydophila pneum...
19703981  74 --FSVDMIVKSRVEAIEYLFKVGCGFYSVIKGEDQILAQVKGAYAEALENEHSSKFLNIIFNKSIELGKKFRTKSMIAHN 151 Fusobacterium nucle...
20138246  71 rrYAESIRVVRGVEAARHLFRVAAGLESMLIGETDILGQVEEAFDRQVKAGFTKGLLKTIVERAIRAGKRVRAETGISRG 150 Pyrobaculum aerophilum
20138300  83 epIGNQARVLCGKDAAKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQIFFERAIKVGRKVREETSISKG 162 Sulfolobus solfatar...
13541421  66 ------YNIISDDMAINHLFHVAAGLDSMSIGENEVLKQVKQAYEKSSSMGKSDKFLSLIFQRAISVGKLVRSKTGIGKG 139 Thermoplasma volcanium
13878528  67 ------PNVLHDEEAIKHLMEVSSGLDSMSLGENEILKQVKEAYELSVRNGKVDKVLSLIFQKAIFVGKKVRSETEISRG 140 Thermoplasma acidop...
20138346  78 npAGGGAISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDAYDAAKDAGGIDHVLREAVTKAMHVGERARTETAINEG 157 Halobacterium sp. N...
1GPJ_A   147 AVSIGSAAVELAERELGS-LHDKTVLVVGAGEMGKTVAKSLVDRGV-RAVLVANRTYERAVELARDLG---GEAVRFDEL 221 Methanopyrus kandleri
7387744  150 GVGYSSAAVSLAASLLGGgLDGARVGIVGAGMAAVGIARALCTRWRpRVVAVFNRTPERGWEVAGKCRgveSLVLPLDEL 229 Aeropyrum pernix
20138297 154 PVSSASIAVNKARQENLR--R---FMVFGFGDVGSLVCKYILSSDF-DVLYIVVRNKAAVS--IKDKR---IKVLSFNEK 222 Clostridium acetobu...
7387749  155 QVTIESVVQEILLSYDKS--IYTNFLFVGYSDINRKVAAYLYQHGY-HRITFCSRQQVTAP--YRTLS---------RET 220 Chlamydophila pneum...
19703981 152 ALSLEAISLKFIKSKFPN-IEDKNIFILGIGELAQDILTLLTKEQL-KNIYIANRTYHKAEQIKKEFDi--VNIVDYREK 227 Fusobacterium nucle...
20138246 151 PAGLGSLSIIYVSQLLD--LTKSKVAVLGAGAVGAGLAKELAERGV-AKLYILNRTLEKAVEIANKLGa-eARPLTREEV 226 Pyrobaculum aerophilum
20138300 163 KVGIYSLAIDEAKKRFND-FYDRRILVIGAGEMAQKITSMLHNEGA-KDVTIMNRTIEKAKQLALKFG-----YNYEKLD 235 Sulfolobus solfatar...
13541421 140 KVSIPSIVYDIVRKNGG--NK---ILLVGNG-MLASEIAPYFSYPQ-YKVTVAGRNIDHVRAFAEKYE---YEYVLINDI 209 Thermoplasma volcanium
13878528 141 KVSVPSIVYDILSSRVV--QK---VLIIGNG-MIAGEIAPYLSG-K-FEVTIAGRNIDHVKDLASKYN---YSYTTINDL 209 Thermoplasma acidop...
20138346 158 ATSLGTAAVRLAERKTQ--LADARAVVVGAGEMGALAAKAFASATV-AEIVIANRTPARAVRVADMVSv-pAEATTLADA 233 Halobacterium sp. N...
1GPJ_A   222 VDHLARSDVVVSATAAPHPVIHVDDVREALRKRDRrspILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR 301 Methanopyrus kandleri
7387744  230 AKLINELDALFVAIAGSTNILERGRVERGVSPR------VIVDISNPPVTPKVAG-----RVFHMPEVEEEAKRMMEERL 298 Aeropyrum pernix
20138297 223 NSYYDDVECMISCTSAPHPVIWEKELPYRKFT--------IFDLAVPRDVEETVYGRNNIDIYDIDQISMIDNNNRKKRK 294 Clostridium acetobu...
7387749  221 LSFRQPYDVIFFGSSESASQFSDLSCESLASIPKR----IVFDFNVPRTFLWKETP-TGFVYLDIDFISECVQKRLQCTK 295 Chlamydophila pneum...
19703981 228 YPKMIEADVIISATSAPHIVVEYDKFVAQMKENKD---YLFIDLAVPRDVDERLANFKNIEIYNLDDIWEVYHLNSMNRD 304 Fusobacterium nucle...
20138246 227 QKCLMECDVVFSSVHSLEYVIDRVPDGAVVK--------IIVDLGVPQTVAPGLP----VRVVRLSDLKQLAEKYSEARK 294 Pyrobaculum aerophilum
20138300 236 LDKLGNFDVAFIS--IYHENLRLENKWNT----------LIVDITVPPLFTGN-------NVITLEELERISNLNFKARE 296 Sulfolobus solfatar...
13541421 210 DSLIKNNDVIITATSSKTPIVEERSLMPG---------KLFIDLGNPPNIER------GNNVITLDEIYEISKKNEMLRE 274 Thermoplasma volcanium
13878528 210 HELIMRNDAIISATSSKTPIIRREEMVEG---------KLYIDLGNPRNIEDKP----GADIITIDDIYSVSNRNGSARM 276 Thermoplasma acidop...
20138346 234 RGRLDAADVVVTATGSPEHVLPASAFADAGDT-------VVVDLAQPRDVAPGAGGHDGVAVHDLDDLEAVTAATRERRE 306 Halobacterium sp. N...
1GPJ_A   302 KEIPKVEKLIEEELSTVEEELEKLKERRLVADVAKSLHEIKDRELERALRRLKT-----GDPE-NVLQDFAEAYTKRLIN 375 Methanopyrus kandleri
7387744  299 RWIPAAEAIIEEELEALLDALSRRRARESSRSVMRALSILAEREYERTLAGLRn-----GVDPrEAVELALNSYTKKVGG 373 Aeropyrum pernix
20138297 295 EIMMANRHIMSKYIVEFYDWQKVQEIVPDIIKLKLYGESVNKRRYETFKNKKa------TKDNdMLVNMLIKSTSNVYIN 368 Clostridium acetobu...
7387749  296 EGVNKAKLLLTCAAKKQWEIYEKKSSHITQRQISSPRIPSVLSY------------------------------------ 339 Chlamydophila pneum...
19703981 305 KLLEDYSYLIDEQMEKLIKTLNYYK------------------------------------------------------- 329 Fusobacterium nucle...
20138246 295 QEAARAEAIVEEELAKLPQILARRYIEEAVSHLLEKAMEVAEEEGKRAGCPT--------------AVLAARTTVKRTLF 360 Pyrobaculum aerophilum
20138300 297 EELAKINKLVEDGINELLYDYKKEIYTEFMSKIMKRIETIRENEILRAYKELEKlg-inDQQAkEILDLMTRSIIKKSFQ 375 Sulfolobus solfatar...
13541421 275 EKINQAEILIENEMKATMNKIKDLMIDDIFSQFYRFASVVQTMEIQKFRKMHP-------EVNeNDLEALAHSIINKILN 347 Thermoplasma volcanium
13878528 277 ESVDEARRIIEIEMASLMNKIKDVMIDEIFADFYKFAVVVQKMEIEKFSRMHP-------EIPaSDVEAFAHSMINKVMN 349 Thermoplasma acidop...
20138346 307 DAAREVEAMIETEFERLLTQYKRKRADEVIARMYESADRLKSREVQTAVHRLEAesgslSADErEVVESMADALVSQLLA 386 Halobacterium sp. N...
1GPJ_A   376 VLTSAIMELP--DEYRRAASRALRRAS---EL 402 Methanopyrus kandleri
7387744  374 ALRRLLEEAS--DRGQLSLEDIEAILVsefAR 403 Aeropyrum pernix
20138297 369 RAIEVLKEEQl-KGRGEDCLRILRRIFqk--- 396 Clostridium acetobutylicum
7387749      -------------------------------- Chlamydophila pneumoniae
19703981     -------------------------------- Fusobacterium nucleatum subsp. nucleatum ATCC 25586
20138246 361 PIIEVLKKMAe-DGRLEDAVKVVEILRsqkPL 391 Pyrobaculum aerophilum
20138300 376 PLFDNIRSLIfnGENSINYINFLIDIFkdgNI 407 Sulfolobus solfataricus
13541421 348 VPVTTLKAVSr-SQGNSDFNRLFESFSsnfND 378 Thermoplasma volcanium
13878528 350 IPVMTLKSVAr-SQSNQDFSRIFSKFYdnfSD 380 Thermoplasma acidophilum
20138346 387 APTKSLRDAA--AEDDWSTIATALELFnpeFE 416 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap