Conserved Protein Domain Family
FeoB

?
COG0370: FeoB 
Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 223447
View PSSM: COG0370
Aligned: 37 rows
Threshold Bit Score: 132.03
Threshold Setting Gi: 18311867
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505   1 MKKLTIGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTIssqtSLDEQIACHY 80
gi 11497862  12 TAEKKVALVGNPNVGKSALFYALTGKYATISNYPGTTVDIAVAKLGDLE----IIDTPGMHSLVPV----TGEEEVARKL 83
gi 15645310   1 MKEITIALVGQPNVGKSSLINALSNAHLKVGNFAGVTVDKMEVGLIHKEHQITIIDLPGTYALNDF----TTEEKVTKDF 76
gi 20094684   1 --MRTVALAGPPNVGKTTIMSRVCRANLEVGNWPGVTVERKTCTYEFRGDRYRLIDLPGTYSLTAF----SEDQRVARDY 74
gi 14521269   1 -MLKVVALVGNPNVGKTTIFNALTGMRQHVGNWPGVTVEKKEGIMEYKGKEYLVVDLPGIYSLTAH----SVDELIARNF 75
gi 18311866     --------------------------------------------------------------------------------
gi 14591027   1 -MLKVVALVGNPNVGKTTIFNALTGMRQHVGNWPGVTVEKKEGIMKYKGEEYLIVDLPGIYSMTAH----SIDELIARNF 75
gi 17229611     --------------------------------------------------------------------------------
gi 15606480   1 MKKITVAVAGNPNVGKTTILNAIAGTALKVGNWPGVTVEKKEATVRYKDYEIHFVDLPGIYTLEPI----SEDEKIAVEF 76
gi 15611694   1 MKEIIVALVGQPNVGKSSLINALSNAHLKVGNFAGVTVDKMEVSLIHKDHQITIIDLPGTYALNDF----TTEEKVTKDF 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505  81 IL---SGDADLLINVVDASNLERNLYLTLQLLELGIP-CIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRG- 155
gi 11497862  84 LE----EA-DLVVHVVDAKNIRRALPFTLQLIEAGFN-TILVLNLVDEAEKFGIFINEKLLEERLGIPVLKTVATEKRGv 157
gi 15645310  77 LE---KGQYDLILNVVDSTNLERNLALSAQLLDTNKK-MLLALNMWDEAQKEGIKINTEKLSKELGVVCVPTSARSKEDr 152
gi 20094684  75 LLgrtDGKPDAVVVVGDALNVAGAVRVFLEIAELGYHhVILAVNMLDEAERAGIGIDLKRLERELGVPVVGISAKRGYG- 153
gi 14521269  76 IL---EGNASVIVDIIDSTCLMRNLFLTLELFEMGVKnVIIALNKIDLLKKRGIHVNIKEMEKILGVPVVPTNAKSGEG- 151
gi 18311866   1 --------------------------------------MILVFNMADLWKP---PYTQEELSKLLSVPVVFTSAVTGEG- 38
gi 14591027  76 IL---EGNASVIVDIIDSSCLMRNLFLTLELFEMGVKnVIIVLNKIDMIKKKGVKIDIKEMERIFGVPVVPTNAKTGEG- 151
gi 17229611     --------------------------------------------------------------------------------
gi 15606480  77 LE---KGNVDVILTVLDSTNLERSLYLTVQLFEFEKP-TVLVLNLYDEAQKLGIEIDEKAFYELLGVKAVKTVGKKGTG- 151
gi 15611694  77 LE---KGQYDLILNVVDSTNLERNLALSAQLLDTNKK-MLLALNMWDEAKKEGININTEKLSQELGVVCVPTSARSKEDr 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 156 --IEALKLAIDRYKANEN---VELVHYAQPLLNEADSLAkVMPSDIplk---qrRWLGLQML-E-GDIYSRAYAGEAS-- 223
gi 11497862 158 grLKDEIRKRIGLKPEKKrliRFSPQVEKVVSEVEGLIEgEYSISK--------RGLAILLL-LkDSVSLEAVKREKN-- 226
gi 15645310 153 lnTELLLDEIVRLYSQNTt--------------------------------------------------nNENIKVP--- 179
gi 20094684 154 --IEHLKRAIADVVQGRVepnPRSPRYPREVERAVKELApEVGERLpey---ppRWAVLKLL-EgDPELLRELEKRDPel 227
gi 14521269 152 --LDELKRKISLMAEGKIttnPIVPRYDEDIEREIQHVS-EVIKGTplaekypiRWLAIKLI-QrDEEVIKLVIKHVGq- 226
gi 18311866     --------------------------------------------------------------------------------
gi 14591027 152 --LDELKRKISLMVEGKIttnPLIPKYDEDIEREIRHVS-EVIKDTplaekysiRWLAIKLL-QrDEEVIKLIIKHVGq- 226
gi 17229611   1 -----MISQVIYPEPIEAaiaQLESWWQTLG--NR-YLFhNYSLSP--------RSLALLLL-QkDPGLWQILQQDQEq- 62
gi 15606480 152 --VEKILPLIVEAYEEKHv--pR-LKYSEELEEFLSEVA--Q------------KYKSLKAQpFtKHELIEFALRDKE-- 210
gi 15611694 153 lnTELLLDEIVRLYSQNTt--------------------------------------------------nNENIKVP--- 179
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 224 -QHLDAALARLRN-EMDd---pALHIADARYQCIAAICDVVSNTLTAE-PSRFTTAVDKIVLNRFLGLPIFLFVMYL-MF 296
gi 11497862 227 ---YPQILEKVSKsNL------LPYEIMREIYENAERILDGVIEE-RDvESSIARKIGILALNPLFGIPLTILSLAF-IY 295
gi 15645310 180 ---SQSFKES-----------------LKYSQSAQRIAQLVISENQQNaSFEHTYKIDKILMHKRYGIFIFLGFMFI-IF 238
gi 20094684 228 lKRVKEVKKRIAErTSHd---pAVLISQARDELATRIARNCVTGRPS---LSRQDRIDRVLTHPVWGTLIALGVLGT-VF 300
gi 14521269 227 -AKIEEILKHVSElEEKykrslDIVIASQKYEFLGELLRKFVRHPTEI-KETLSDQLDKLLTHPVYGIVSMLVVFYI-LF 303
gi 18311866  39 ---VARLRELLFKn-----------------VPKSSLRLQDLKVPEYAvIKSAILSRPPIALATLLALGVLTTIFLMaVI 98
gi 14591027 227 -AKIDEVLKHVSElEEKykrslDIVIASQKYEFLHEILRKFVQHPKEV-RETLSDQLDKLLTHPVYGTISMLIVFYI-LF 303
gi 17229611  63 -CRHLEVLITVTQnQLHq---pLGLAIANTRQSQARTIERAVLHEAREaRSSITETIHKLTVNPITGFPILVVILYYgVY 138
gi 15606480 211 --LQKKFKEKYGKeFKK-------YLEDERYAFAHGIYEEVVKQKGID-VRTLTDFLDNLLLHPVLGFVFFVVIMFL-LF 279
gi 15611694 180 ---SQSFKES-----------------LKYSQSAQRIAKSVISENKQNaSFEHTYKIDKILMHQRYGIFIFLGFMFI-IF 238
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 297 LLAINIGG-ALQPLFDVGSVa----LFVHGIQWIGYTLHFPDWLTIFLAQGLGGGINTVLPLVPQIGMMYLFLSFLEDSG 371
gi 11497862 296 LLAGILGAqILVDLIETWFEenvntAVNTFLEQNIPNYWLRELIGGEYGIITLGIRYAIAIIFPIVTTFFIAFSLLEDSG 375
gi 15645310 239 SLSFLIGG-GVQKALETGFK-----FLSDGIKENVANEDLASLVG----DGIIGGVGATVSFLPLIVVLYFGISLLETTG 308
gi 20094684 301 ASAFLLGD-PLSELVEGAFE-----HLAGFARS-LPAP-WSDLLA----EGVIPGVGTVLAMYPYVFVMLLLLTVLEDAG 368
gi 14521269 304 QFVFSLGG-PLQELLDNAFS-----SFGEWLGERIANETLRGLVV----DGIIGGVGAVLSFFPLVFLLFVGMSILEDSG 373
gi 18311866  99 EGITPWGG-NLPVSLVSLFD-----LLDQHVSQA-VMASIGGPAGRFIIEALWESVLTLLILSVYVIIAFTLIVLYEDSG 171
gi 14591027 304 QFVFAVGG-PLQELLDDAFS-----SFGEWLGERIANETIRGLVV----DGIIGGVGTVLSFFPLVFLLFVGMSILEDSG 373
gi 17229611 139 KFVGEFGAgELVDRIESFFEsqinpLVNQVTAQIIPWRPIQDLIAHDYGIITLGIRYATAIVLPVVATYFLMFSLLEDSG 218
gi 15606480 280 KVTFDFSS-PFVDWVDGFFTd----FLNPAVKEFLASLGAPEFISRFFSEAVIGGVGFVLTFVPLIFTLYFLITFLEMSG 354
gi 15611694 239 SLSFLIGG-GVQKALEEGFK-----ILSDSIKENVANEDLASLVG----DGIIGGVGATVSFLPLIVVLYFGISLLETTG 308
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 372 YMARAAFVMDRLMQALGLPGKSFVPLIVGFGCNVPSVMGARTLDAPRERLMTIMMAPFMS-CGARLAIFAVFAAAFFGQN 450
gi 11497862 376 ILPRTAYLLDGIFKKIGMSGRAVIPLLLGTGCGTMAVIVTRILETWRERVIATILLAVGIpCSAQLGVMLG-IAPDFRAM 454
gi 15645310 309 YMSRVAFLLDGILHKFGLHGKSFIPLITGFGCSVPAYMATRTLQNYNERLITLFVIGFMS-CSARLPIYVLFVGSFFPSS 387
gi 20094684 369 YTARLAALASGLLARFGLHGKTVFPAVLSLSCNVPAITASRIIEDERARLLTAIVVPLIP-CGARLEVITFLTAKLPDPW 447
gi 14521269 374 YLARVAAVMERYLRMFKLPGKAIIPMVLAFGCNVPAVMATRILEEEKDRILTMLVNPLIP-CVARMTVITFLAGTFFPDK 452
gi 18311866 172 LIALLSKSVERRLSYLGIPPRGVVCLFVAASCNVPAATTAKALWGRGSRVLTALLTPYVP-CVARLAIFVAVAAAALSRI 250
gi 14591027 374 YLARVAAVMERYLRVFKLPGKAIIPMVLAFGCNVPAVMATRILEEEKDRILTMLINPLIP-CVARMTVITFLAGTFFPNK 452
gi 17229611 219 YLPRLSLMLDRLFKSVGLSGRAVIPMVLGLGCDTMATIVTRTLETRRERLIATFLLSLAIpCAAQWGVIVGLLAQKPAAL 298
gi 15606480 355 YVPRVAFLMDKFLHRMGLHGKSVIPLILALGCNVPAIVATRTLETTREKLIVIAMIPFIS-CPARLVVFSFFAITFFPNN 433
gi 15611694 309 YMSRVAFLLDGILHKFGLHGKSFIPLITGFGCSVPAYMATRTLQNYNERLITLFVIGFMS-CSARLPIYVLFVGSFFPSS 387
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 451 ---GALAVFSLDMLGIVMAVLTGLMLKYTIMRG--EATPFVMELPVYHVPHVKSLIIQTWQRLKGFVLRAGKVIIIVSIF 525
gi 11497862 455 m---------IWISVVTAVLLIAGFISSRVIPG--ERAVFFMEIPPIRVPRPENVFYKTVSRLEWYFKEVLPIFVLISVL 523
gi 15645310 388 s--AGFVLFCIYILGAVVALVMAKLLKLSVFKG--QTESFIMEMPKYRFPSWRMVYFSIYTKSLSYLKKAGTYILVGAIL 463
gi 20094684 448 r---VPAAVSIYVVALSLFVATSYILHRLLFGKpePHRGHVIELPRLRKPHLRTVLTVTWLRSNEFLQKAGTIILAASVL 524
gi 14521269 453 ---AALVAVSIYAIAIVLALISALILGKLVVKS--EESPFIIELPEYSIPSWKTVVLHSWERSKEFLRKAATVILLGSIL 527
gi 18311866 251 pylIPVAVFIPYLISFGFALIASFIYRKALGIK--TEAIGIVPPAPLMWPRWNIYFKKVAVSYKEFILKVGPLLSAVIIA 328
gi 14591027 453 ---AALVAVSIYVIAIAIALISAFILGKFVVKS--EESPFIIELPEYSIPSWRTIAIHSWERSKEFLRKAATVILLGSIL 527
gi 17229611 299 i---------FWGGFITAIFLVVGYLTARLLPG--TSGRFYMEIPPLRLPKLRNVFTKTWVRMKWYFLEVLPLFIWASVL 367
gi 15606480 434 ---AALVITGLYLLGVAVALLTAFLMRKSIARG--ASSHFVIELPPYRMPSLKTVLNISWIHVKDFLYRAGTLIFAASIF 508
gi 15611694 388 s--AGFVLFCIYILGAVVALVMAKLLKLSVFKG--QTESFIMEMPKYRFPSWRMVYFSIYTKSLSYLKKAGTYILVGAIL 463
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 526 LSAFNSFSlsGKIVD------------------------------------NINDSALASVSRVITPVFKPIGVHedNWQ 569
gi 11497862 524 IWIGRITT------------------------------------------------AFDIIVSALSVPVSAIGLP---PK 552
gi 15645310 464 IWFMSQYP--KSDAAmkaykqesllvnkdttlsseakeeklkelkteldkkNLKNSIVGRGGAYLEKVFSPMDF---DWR 538
gi 20094684 525 LWVATRYPe-PLG---------------------------------------TGGSAIELVGKALEPVTVALLGl--DWK 562
gi 14521269 528 IWYLSSYPe-PVG---------------------------------------SGISYAEKLGRAFEPIARLMGL---DWK 564
gi 18311866 329 LWPLSAYG--PGGYVe-----------------------------------DISQSYLAAIGNALEPLFEPMGLP---WQ 368
gi 14591027 528 IWYLSSYPe-PVG---------------------------------------SGVSYAEKLGRILEPLAKLMGL---DWK 564
gi 17229611 368 IWVGRLTG------------------------------------------------LFDVIIRAIEPLTLALGMP---KQ 396
gi 15606480 509 IWILLNLP--PNVK-------------------------------------NPKDSLAADIGRVLVPVFEPMGIS--DWR 547
gi 15611694 464 IWFMSQYP--KNDAAmktykqesllvqknanlsseakeeklkelkteldkkNLKNSVVGRGGAYLEKVFNPMDF---DWR 538
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15833505 570 ATVGLFTGAMAKEVVVGTLNTLYTAEniqdeefnpaefnlgeelfsavdetwqslkdtfslsvlmnpieaskgdgEMGtg 649
gi 11497862 553 ASEVFLYGFFRRDYGAAGLFDISS-------------------------------------------------------- 576
gi 15645310 539 LSVSLVTGFMAKEVVVSTLGVLFSLGd-----------------------------------------------qNEKsd 571
gi 20094684 563 GAVALLNGIVAKEIVISTLAMLHAH------------------------------------------------------- 587
gi 14521269 565 AAVSLIFGIIAKENVIATYSVIYGVS-------------------------------------------------EES-- 593
gi 18311866 369 VVMPLVGGWIFKEVVLGLLEATGG-------------------------------------------------------- 392
gi 14591027 565 AAVSLIFGIIAKENVIATYSVIYGVS-------------------------------------------------EES-- 593
gi 17229611 397 AAPIFLYGFFRRDYGAAGLFDLQQ-------------------------------------------------------- 420
gi 15606480 548 ATTSLIPAFLAREIVLSSMGVIYTATevvqekekfsfseelknqlsgl-----leatktavksvfslkiqaleveEEEtg 622
gi 15611694 539 LSVSLVTGFMAKEVVVSTLGVLFSLGd-----------------------------------------------qNEKsd 571
                       730       740       750       760       770       780       790
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15833505 650 aMGVMDQKFGSAAAAYSYLIFVLLYVPCISVMGAIARESS-RGWMGFSILWGLNIAYSLATLFYQVASYSQH 720
gi 11497862 577 -----EG-LLSYGQVVVAMVTLTLFVPCIAQFSIICKERG-IKQGIAVFLLSVAIAFTAGYAT---AVMMGV 638
gi 15645310 572 aFRGILRKEVSVPSGIAFIVFVMFYIPCFAATITFGREAGgIKFVAYLFIFTTVVAYAFSLIAFYATQILV- 642
gi 20094684 588 ---------LTPENAYVLTLVSALYIPCAATIGAVYSETGsMRYAALSVAANLSLATLVGAAVHHALVALGG 650
gi 14521269 594 -LGSAMAHIMTPLQAYVLALVTTLYLPCIATIAAIRAEGG-WKWAGVAVVYNLILATVVGIIAYHIGAVL-- 661
gi 18311866 393 ---LQIISTLPLSSIMAFLVFTAFYSACIATLSVLYRTVG-LKLTALSVVVNLALAYIAALAVYAALSLVPL 460
gi 14591027 594 -LGSAMIHAMTPLQAYILALVTTLYFPCLATIGAIRAEGG-MKWATIAIIYNLLLATTVGIIAYHLGLLV-- 661
gi 17229611 421 -----QG-SLTGNQLVIAAIVLTLFLPCIAQLQMLIKERG-TKTTLAIVLFIFPFAFLMGYVVNLGLILFGV 485
gi 15606480 623 qLRDLIRNSFTPASAFAFMVFILIYTSCLGTYATMGREIG-YGKATAFLVYSFVLAWIIGTISYKLLS---- 689
gi 15611694 572 aFREIIRKEVSVPSGIAFIVFVMFYIPCFAATITFGREAGgIKFVAYLFIFTTVVAYAFSLIAFYATQILV- 642
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap