Conserved Protein Domain Family
DnaG

?
COG0358: DnaG 
DNA primase (bacterial type) [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223435
View PSSM: COG0358
Aligned: 70 rows
Threshold Bit Score: 131.078
Threshold Setting Gi: 1351456
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17986813  28 RFPPSFLDEIRDRVPISTLIGtrvsfDRKKSNPPKGD----FWACCPFHGEKTPSFHCEDRKGRYHCFGCGVTGDHFKFL 103 Brucella melitensis
6686253    1 ---------------------------------MNGVc---RRMKYLIRARLEVDGRVEKHDVIGAIFGQTES------- 37  Aeropyrum pernix
6686178    1 --------------------------------MIIMDl---GTTKYIIYAELIADGYVEKHDVIGAIFGQTEG------- 38  Methanocaldococcus ...
18313106   1 ---------------------------------MGALt---IVAKYMIVAQIEVNGSVDKSDIIGALFSQTEG------- 37  Pyrobaculum aerophilum
17545558   1 ---------------MLDFND-------SPSQSREVAr---PASSDGERERIRGLLLDRLDSVLAILFPAGKKRRNKFVI 55  Ralstonia solanacearum
17547948   1 ---------------MIDFNE-------IPLVTG---------QLDAQRDEIRAALLARLEFVLSVLFPAGKKRRGTFVV 49  Ralstonia solanacearum
6686208    1 ------------------------------------Ms---FQMKYDIRLRFEVEGIVEKTDVIGAIFGQTEN------- 34  Sulfolobus solfatar...
13540987   1 ---------------------------------MNVDp---NLTKYMIKAKIYTDGVVEKPDVVGAIFGQTEG------- 37  Thermoplasma volcanium
16082482   1 ---------------------------------MNVDp---NLTKYMIKAKIYTDGVVEKPDVVGAIFGQTEG------- 37  Thermoplasma acidop...
15790701   6 ASHPGLIIGFRGWLPGRRFHAahdryLTTPVIQQCNTkpmeDTAKYLIHADFVVDGVVERSDVVGAAFGQTEG------- 78  Halobacterium sp. N...
17986813 104 TDLEGLSFPEAVERVADMAGvpmpardpemekREAQRATLYDVMELAAQFFESQLQsatgakaraYLRDRGLSTATQQAF 183 Brucella melitensis
6686253   38 --LLGSDFSLEELQNKDKLG------------RIHVELKYQGTKTIGSISVPSNLS---------RVETAIIAAMLETID 94  Aeropyrum pernix
6686178   39 --LLGDELDLRELQKTGRVG------------RIDVELTNINGKSIAKITVPSSLD---------RIETSILAATLETID 95  Methanocaldococcus ...
18313106  38 --LLGKDMDLRELQMMGRIG------------RIEVDIFEKNGKTKAKIHIPSNLD---------RYETALVAALIESIE 94  Pyrobaculum aerophilum
17545558  56 GDIQGNLGDSLEIVLDGEKA------------GLWTDRATGDGGDVFAVIAGTLGV---------DVQTEFPRVLARAAD 114 Ralstonia solanacearum
17547948  50 GDILGSPGDSLEVVLDGEKA------------GLWTDRATGDGGDIFDLIAAQAGL---------RVSTDFSGVLERALQ 108 Ralstonia solanacearum
6686208   35 --LFGDEFDLRELQDKGRLG------------RIIVEVKTKGGKSEGEIIIPSNLD---------RIETALIAAMVESVD 91  Sulfolobus solfatar...
13540987  38 --LLGDDLDLRDLQKSGKIG------------RIEVEIDSKKGRTEGYALIPSGLD---------QVETAILAAALETID 94  Thermoplasma volcanium
16082482  38 --LLGDDLDLRDLQKSGKIG------------RIEVEIDSKKGRTEGYALIPSGLD---------QVETAILAAALETID 94  Thermoplasma acidop...
15790701  79 --LLGDDLAIPDLQDSAKLG------------RIDVSVDSEGGQSFGDITIASSLD---------RVETATLAAALEAVE 135 Halobacterium sp. N...
17986813 184 RMGYAPESrnalkeFLAGKGvsREQIEACGLVVHGegiaVSYDRFRDRVMFPIEDLRGRIIAFGGRALSadapaKYLNSP 263 Brucella melitensis
6686253   95 KIG-----------PYPAKIt-IEEIRDLRLERLE----KIKQRARELLR-LMKEKEPDIREIIREVLQe----EQAKAQ 153 Aeropyrum pernix
6686178   96 RVG-----------PCVATVk-VIDIEDIRKKKRE----YIVERAKEILKQLMSN--IDVNTIIEEVK--------ESVR 149 Methanocaldococcus ...
18313106  95 RVG-----------PYPAAVk-VVEIRDLREEKRK----KIIEKAKELVKLIEEEILPDTKEIIEKLK--------EDVA 150 Pyrobaculum aerophilum
17545558 115 LLGLASTQ------PVRRKRk-EPPTDDLGPETAK----WDYLDAAGRLIGVVYR--YDPPGRGKEFR-------PWDAK 174 Ralstonia solanacearum
17547948 109 LLGQASKQ------PVRRKRr-EPPTDDLGPETAK----WDYLDAAGKLIGVVYR--YDPPGRGKEFR-------PWDAK 168 Ralstonia solanacearum
6686208   92 KVG-----------PYNSKFe-LIEIEDIRAEKLK----KIIERAKGILSSWSKEKSLDIKEVINEIS--------SAVK 147 Sulfolobus solfatar...
13540987  95 RIG-----------PCKAKVe-IANVEDVRVQKRQ----KIIERAKKIYQDMNSKGDDLSESLVKSVR--------EEVE 150 Thermoplasma volcanium
16082482  95 RIG-----------PCKAKVe-IANVEDVRVQKRQ----KIIERAKKIYQDMNSKGDDLSESLVKSVR--------EEVE 150 Thermoplasma acidop...
15790701 136 RIG-----------PCRADVe-VDRIEDVRAAKRR----EVVDRAKELLATAFDEGAINADDILDEVR--------ESVR 191 Halobacterium sp. N...
17986813 264 ETELFHKGRVLYNGLRARKAcqpQGgepakPIIAVEGYMDVIALAQAGIHHVVAPLGTA-LTEEQLELLWRISPEPILCF 342 Brucella melitensis
6686253  154 VAKLVEYGPERLPAGPGVEK---AD-----TIIVVEGRSDVNTLLRYGYTNVIALGGAReKVPETIKRLAEQKK-VILFV 224 Aeropyrum pernix
6686178  150 MGEIIEYGPERLPAGPAVDS---SD-----DIIVVEGRADVLNLLRCGIKNVIAVEGTS--VPKTIIELSKKKI-VTVFT 218 Methanocaldococcus ...
18313106 151 KAEIIEYGPERLPAGPDVDK---SD-----SIIIVEGRADVVNLVKHGYRNVIALEGISrGVPQTIIELSKKKN-VTVFI 221 Pyrobaculum aerophilum
17545558 175 RRKMAPPDPRPLYNQPGLAS---AT-----QVVLVEGEKCAQALIDAGIVATTAMHGANaPVEKTDWSPLAGKA-VLIWP 245 Ralstonia solanacearum
17547948 169 RRKMAPPEPRPLYNQPGLAT---AT-----QVVLVEGEKCAQALIDIGIVATTAMHGANaPVEKTDWSPLAGKA-VLIWP 239 Ralstonia solanacearum
6686208  148 VGEITEYGPERLPAGPDVDK---DP-----NLIIVEGRADVINLLRYGYKNVIAVEGATsRIPETLINLSKMKKTVIAFL 219 Sulfolobus solfatar...
13540987 151 KSEIISYGEEKLPAGPAIND---SD-----SIIVVEGRNDVLNLLKYGIKNTIAVQGTN--IPETVKKLSKERT-VTVFL 219 Thermoplasma volcanium
16082482 151 KSEIISYGEEKLPAGPAIND---SD-----SIIVVEGRNDVLNLLKYGIKNTIAVQGTN--IPETVKKLSKERT-VTVFL 219 Thermoplasma acidop...
15790701 192 VDDITDYDG--YPAGPNVDS---SD-----AVVIVEGRADVVTLLKYGIKNAVAVEGTN--IPDAIAALSR-EKTATAFL 258 Halobacterium sp. N...
17986813 343 DGDGAGLRAAYRAADLGLPVLQPGkslrfalLPEGQDPDDLVKAEGPSAFHAVLRDArPLVEMVWTRETAGG-----VFD 417 Brucella melitensis
6686253  225 DGDRGGELILKNVLP-QMKVDYVAr------APEGREVESLTGREIAQALSQMKPAEiVARELGI--------------- 282 Aeropyrum pernix
6686178  219 DGDRGGELILKELLQ-VCDVDFVAr------APPGKEVEELSKKEIMKCLRSKIPAEhILAQILKDKQ------------ 279 Methanocaldococcus ...
18313106 222 DGDKGGELVLRELLK-VAHVDYIAr------APPGKEVEQLTAKEIAKALRNKITLEeWLAQQ----------------- 277 Pyrobaculum aerophilum
17545558 246 DRDKPGWEYADRASQAILQAGALLv------AILLPPDDKPEGWDAADAIEEGFDVAgYLAAGARVPVVP---------- 309 Ralstonia solanacearum
17547948 240 DRDKPGWEYAANAAQAILSAGATTc------HILYPPEEAGEGWDAADAVAEGFDIAaFIAHGPRLQMhdvvddpepvig 313 Ralstonia solanacearum
6686208  220 DGDHGGDLILKELLSNNVKIDFVAr------APIGREVEELTGKEIAKALSNMMPLTqYLKKV-Q--------------- 277 Sulfolobus solfatar...
13540987 220 DGDRGGDLILKEMLQ-VAEVDFVAr------APPGTEVEELTYKQIVKALRYKTPIDqYLSMHGMNDELKEYsqrnnLVF 292 Thermoplasma volcanium
16082482 220 DGDRGGDLILKEMLQ-VAEADFVAr------APPGTEVEELTYKQIVKALRYKTPIDqYLSMHGMNDELKEYsqrnnLVF 292 Thermoplasma acidop...
15790701 259 DGDRGGDMILRELGQ-VGSLDFVAr------APMGECVEDLSRRTVDSALRNKTPASaAAPIATTQSET----------- 320 Halobacterium sp. N...
17986813 418 TperraeLEARLREITSRIANEDIRRhysqdmreraqaffgQGRQGFQNGGQRSQSftrrnegargrggpagsgrlaiSD 497 Brucella melitensis
6686253  283 ---------EAAEKPAEEAVKREEEA----------------AAEAKPPAPAVQEKaa-------------------kPP 318 Aeropyrum pernix
6686178  280 ---------KIDEKVCKDEIRNMGi---------------qTIPEIKPEISITSND------------------------ 311 Methanocaldococcus ...
18313106 278 ---------KAAGEKAETPQQPPPQ---------------------QP---VPQQ------------------------- 299 Pyrobaculum aerophilum
17545558 310 ---------EVDDSVSADVLEGVDwetedglataftrrygddwrycslwgkwlvwtgvrwnpdqllyithlsrgicraas 380 Ralstonia solanacearum
17547948 314 sdesvwgtedalalaftrryhrdwryvaawgrwlvwdghrwrtedtlaatdlirnvcrhaalhaenprlaaklatsgtia 393 Ralstonia solanacearum
6686208  278 ---------EAEQAIAKNVIAKEE----------------------KP----IQS------------------------- 297 Sulfolobus solfatar...
13540987 293 T--------NHNSEQKKEVLEEP----------------------EAEKNEVLEQG------------------------ 318 Thermoplasma volcanium
16082482 293 Gs-----QPNNNHEAKAEVIEEPP--------------------EQPPKNEEIRE------------------------- 322 Thermoplasma acidop...
15790701 321 ---------AATDGSATPAPTPEP----------------------APDTAPSPD------------------------- 344 Halobacterium sp. N...
17986813 498 SLARSTLVKGGRqggaahaplretaivLTLlNHPRLIEEDFETLAALDLGHDAlkTLHLAMLDVLaagrvdDG-IAMRRA 576 Brucella melitensis
6686253  319 EEKPPTVKFTIP--------------------------KAVLEAAKELRGTLE--AIVYDKEWRE------LDrLKVREL 364 Aeropyrum pernix
6686178  312 DVEVSSVECNPS---------------NNE--ELPPKYNKYRKFYEKLIELED--SKVLIINGDK------EEiVSIEEL 366 Methanocaldococcus ...
18313106 300 EVREEAQKPAFP--------------------------FDITKKIDEMLGTLE--AEIYDENWTL------VKrLPVREL 345 Pyrobaculum aerophilum
17545558 381 fkaetprqkaklassstiasvekiarsdpkhaatadewdadvwalntpggvvdlrtgqlrahrredrmtkvttatpkgdc 460 Ralstonia solanacearum
17547948 394 gverlaradrrhaattsewdadpwllntpggvvdlrtgrqrphdrddrmtkittatpvgdcptwrqflaevtggdvelqa 473 Ralstonia solanacearum
6686208  298 ETTQQVVQITLP--------------------------QNILEEIKKLPGTLE--GVLYDNNWNL------IEkVQVRDI 343 Sulfolobus solfatar...
13540987 319 EVTQQVSVPKEG-------------------YLDLLNPHDVSRRIEALSQLKT--TEIYDSNGQR------IAsFPVAEA 371 Thermoplasma volcanium
16082482 323 EQSQQVTVQKEG-------------------FLDLLNPHEVSKRIEALAQLKM--TEVYDSNGER------IFsFPVSEA 375 Thermoplasma acidop...
15790701 345 SDGDDTEAAAPP---------------------------TLAEHARAVADTET--ARLLDDALAR------IReVPAAEV 389 Halobacterium sp. N...
17986813 577 LVdaghgdLIKMLEQVVKGAKLWTATTLaaeddaREALRQALHLHQRARTLHKELRAVEAALetdetGELFARLRDIQNQ 656 Brucella melitensis
6686253  365 YD------YISKSEPGRIYAVVFDGIIT------QRLLDIASEKGVGIIIGNRIGNKITHKP-----TNVKFLTFSDLF- 426 Aeropyrum pernix
6686178  367 IN------NTDNYKSID--AIIINGTVT------QKLIDILYEK--TNLIFCKDA-KIIKKP-----VNLTLITFGDLNA 424 Methanocaldococcus ...
18313106 346 PD------FLTTSGDS-IYAIILDGITT------QRIVDLAAKKGVKIIVTARTG-PLTKVP-----ENMQILTFDQLKK 406 Pyrobaculum aerophilum
17545558 461 ptwrqflsevtggdvelqaylqrmagyaltgstqehalfflygtgangksvfvntlatilgdyavnaamdtfmetradrh 540 Ralstonia solanacearum
17547948 474 ylqrmagyaltgstqehalfflygtgangksvfvntlatilgdyaanaamdtfmetradrhptdmaglrgarfvaaiete 553 Ralstonia solanacearum
6686208  344 IP------KLEAYEDNKVAYIIFDGVIT------QRLLDLASQKNIKMIIGARIG-GINKRP-----QNVDILTFTDIIS 405 Sulfolobus solfatar...
13540987 372 VD------RIIQDPQGN--TIVTGGIIS------QRLIDVAYNAGIKNIYGLKLG-HITKKP-----VDINVIAWDRST- 430 Thermoplasma volcanium
16082482 376 VE------RISQDPRGN--TIVTGGIIS------QRLIDVSYNAGIKNIYGLKLG-HITKKP-----VDINVIAWERSL- 434 Thermoplasma acidop...
15790701 390 VD------AVADADSVP-AVVVVDATIT------QRLLDVAAQRGVASLIGADTD-EFVKQP-----LATRVRTLDDART 450 Halobacterium sp. N...
17986813 657 I 657 Brucella melitensis
6686253      - Aeropyrum pernix
6686178      - Methanocaldococcus jannaschii
18313106 407 V 407 Pyrobaculum aerophilum
17545558 541 p 541 Ralstonia solanacearum
17547948 554 q 554 Ralstonia solanacearum
6686208  406 S 406 Sulfolobus solfataricus
13540987     - Thermoplasma volcanium
16082482     - Thermoplasma acidophilum
15790701     - Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap