Conserved Protein Domain Family
DnaG

?
COG0358: DnaG 
DNA primase (bacterial type) [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223435
View PSSM: COG0358
Aligned: 70 rows
Threshold Bit Score: 131.078
Threshold Setting Gi: 1351456
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813  28 RFPPSFLDEIRDRVPISTLIGtrvsfDRKKSNPPKGD----FWACCPFHGEKTPSFHCEDRKGRYHCFGCGVTGDHFKFL 103
gi 6686253    1 ---------------------------------MNGVc---RRMKYLIRARLEVDGRVEKHDVIGAIFGQTES------- 37
gi 6686178    1 --------------------------------MIIMDl---GTTKYIIYAELIADGYVEKHDVIGAIFGQTEG------- 38
gi 18313106   1 ---------------------------------MGALt---IVAKYMIVAQIEVNGSVDKSDIIGALFSQTEG------- 37
gi 17545558   1 ---------------MLDFND-------SPSQSREVAr---PASSDGERERIRGLLLDRLDSVLAILFPAGKKRRNKFVI 55
gi 17547948   1 ---------------MIDFNE-------IPLVTG---------QLDAQRDEIRAALLARLEFVLSVLFPAGKKRRGTFVV 49
gi 6686208    1 ------------------------------------Ms---FQMKYDIRLRFEVEGIVEKTDVIGAIFGQTEN------- 34
gi 13540987   1 ---------------------------------MNVDp---NLTKYMIKAKIYTDGVVEKPDVVGAIFGQTEG------- 37
gi 16082482   1 ---------------------------------MNVDp---NLTKYMIKAKIYTDGVVEKPDVVGAIFGQTEG------- 37
gi 15790701   6 ASHPGLIIGFRGWLPGRRFHAahdryLTTPVIQQCNTkpmeDTAKYLIHADFVVDGVVERSDVVGAAFGQTEG------- 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 104 TDLEGLSFPEAVERVADMAGvpmpardpemekREAQRATLYDVMELAAQFFESQLQsatgakaraYLRDRGLSTATQQAF 183
gi 6686253   38 --LLGSDFSLEELQNKDKLG------------RIHVELKYQGTKTIGSISVPSNLS---------RVETAIIAAMLETID 94
gi 6686178   39 --LLGDELDLRELQKTGRVG------------RIDVELTNINGKSIAKITVPSSLD---------RIETSILAATLETID 95
gi 18313106  38 --LLGKDMDLRELQMMGRIG------------RIEVDIFEKNGKTKAKIHIPSNLD---------RYETALVAALIESIE 94
gi 17545558  56 GDIQGNLGDSLEIVLDGEKA------------GLWTDRATGDGGDVFAVIAGTLGV---------DVQTEFPRVLARAAD 114
gi 17547948  50 GDILGSPGDSLEVVLDGEKA------------GLWTDRATGDGGDIFDLIAAQAGL---------RVSTDFSGVLERALQ 108
gi 6686208   35 --LFGDEFDLRELQDKGRLG------------RIIVEVKTKGGKSEGEIIIPSNLD---------RIETALIAAMVESVD 91
gi 13540987  38 --LLGDDLDLRDLQKSGKIG------------RIEVEIDSKKGRTEGYALIPSGLD---------QVETAILAAALETID 94
gi 16082482  38 --LLGDDLDLRDLQKSGKIG------------RIEVEIDSKKGRTEGYALIPSGLD---------QVETAILAAALETID 94
gi 15790701  79 --LLGDDLAIPDLQDSAKLG------------RIDVSVDSEGGQSFGDITIASSLD---------RVETATLAAALEAVE 135
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 184 RMGYAPESrnalkeFLAGKGvsREQIEACGLVVHGegiaVSYDRFRDRVMFPIEDLRGRIIAFGGRALSadapaKYLNSP 263
gi 6686253   95 KIG-----------PYPAKIt-IEEIRDLRLERLE----KIKQRARELLR-LMKEKEPDIREIIREVLQe----EQAKAQ 153
gi 6686178   96 RVG-----------PCVATVk-VIDIEDIRKKKRE----YIVERAKEILKQLMSN--IDVNTIIEEVK--------ESVR 149
gi 18313106  95 RVG-----------PYPAAVk-VVEIRDLREEKRK----KIIEKAKELVKLIEEEILPDTKEIIEKLK--------EDVA 150
gi 17545558 115 LLGLASTQ------PVRRKRk-EPPTDDLGPETAK----WDYLDAAGRLIGVVYR--YDPPGRGKEFR-------PWDAK 174
gi 17547948 109 LLGQASKQ------PVRRKRr-EPPTDDLGPETAK----WDYLDAAGKLIGVVYR--YDPPGRGKEFR-------PWDAK 168
gi 6686208   92 KVG-----------PYNSKFe-LIEIEDIRAEKLK----KIIERAKGILSSWSKEKSLDIKEVINEIS--------SAVK 147
gi 13540987  95 RIG-----------PCKAKVe-IANVEDVRVQKRQ----KIIERAKKIYQDMNSKGDDLSESLVKSVR--------EEVE 150
gi 16082482  95 RIG-----------PCKAKVe-IANVEDVRVQKRQ----KIIERAKKIYQDMNSKGDDLSESLVKSVR--------EEVE 150
gi 15790701 136 RIG-----------PCRADVe-VDRIEDVRAAKRR----EVVDRAKELLATAFDEGAINADDILDEVR--------ESVR 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 264 ETELFHKGRVLYNGLRARKAcqpQGgepakPIIAVEGYMDVIALAQAGIHHVVAPLGTA-LTEEQLELLWRISPEPILCF 342
gi 6686253  154 VAKLVEYGPERLPAGPGVEK---AD-----TIIVVEGRSDVNTLLRYGYTNVIALGGAReKVPETIKRLAEQKK-VILFV 224
gi 6686178  150 MGEIIEYGPERLPAGPAVDS---SD-----DIIVVEGRADVLNLLRCGIKNVIAVEGTS--VPKTIIELSKKKI-VTVFT 218
gi 18313106 151 KAEIIEYGPERLPAGPDVDK---SD-----SIIIVEGRADVVNLVKHGYRNVIALEGISrGVPQTIIELSKKKN-VTVFI 221
gi 17545558 175 RRKMAPPDPRPLYNQPGLAS---AT-----QVVLVEGEKCAQALIDAGIVATTAMHGANaPVEKTDWSPLAGKA-VLIWP 245
gi 17547948 169 RRKMAPPEPRPLYNQPGLAT---AT-----QVVLVEGEKCAQALIDIGIVATTAMHGANaPVEKTDWSPLAGKA-VLIWP 239
gi 6686208  148 VGEITEYGPERLPAGPDVDK---DP-----NLIIVEGRADVINLLRYGYKNVIAVEGATsRIPETLINLSKMKKTVIAFL 219
gi 13540987 151 KSEIISYGEEKLPAGPAIND---SD-----SIIVVEGRNDVLNLLKYGIKNTIAVQGTN--IPETVKKLSKERT-VTVFL 219
gi 16082482 151 KSEIISYGEEKLPAGPAIND---SD-----SIIVVEGRNDVLNLLKYGIKNTIAVQGTN--IPETVKKLSKERT-VTVFL 219
gi 15790701 192 VDDITDYDG--YPAGPNVDS---SD-----AVVIVEGRADVVTLLKYGIKNAVAVEGTN--IPDAIAALSR-EKTATAFL 258
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 343 DGDGAGLRAAYRAADLGLPVLQPGkslrfalLPEGQDPDDLVKAEGPSAFHAVLRDArPLVEMVWTRETAGG-----VFD 417
gi 6686253  225 DGDRGGELILKNVLP-QMKVDYVAr------APEGREVESLTGREIAQALSQMKPAEiVARELGI--------------- 282
gi 6686178  219 DGDRGGELILKELLQ-VCDVDFVAr------APPGKEVEELSKKEIMKCLRSKIPAEhILAQILKDKQ------------ 279
gi 18313106 222 DGDKGGELVLRELLK-VAHVDYIAr------APPGKEVEQLTAKEIAKALRNKITLEeWLAQQ----------------- 277
gi 17545558 246 DRDKPGWEYADRASQAILQAGALLv------AILLPPDDKPEGWDAADAIEEGFDVAgYLAAGARVPVVP---------- 309
gi 17547948 240 DRDKPGWEYAANAAQAILSAGATTc------HILYPPEEAGEGWDAADAVAEGFDIAaFIAHGPRLQMhdvvddpepvig 313
gi 6686208  220 DGDHGGDLILKELLSNNVKIDFVAr------APIGREVEELTGKEIAKALSNMMPLTqYLKKV-Q--------------- 277
gi 13540987 220 DGDRGGDLILKEMLQ-VAEVDFVAr------APPGTEVEELTYKQIVKALRYKTPIDqYLSMHGMNDELKEYsqrnnLVF 292
gi 16082482 220 DGDRGGDLILKEMLQ-VAEADFVAr------APPGTEVEELTYKQIVKALRYKTPIDqYLSMHGMNDELKEYsqrnnLVF 292
gi 15790701 259 DGDRGGDMILRELGQ-VGSLDFVAr------APMGECVEDLSRRTVDSALRNKTPASaAAPIATTQSET----------- 320
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 418 TperraeLEARLREITSRIANEDIRRhysqdmreraqaffgQGRQGFQNGGQRSQSftrrnegargrggpagsgrlaiSD 497
gi 6686253  283 ---------EAAEKPAEEAVKREEEA----------------AAEAKPPAPAVQEKaa-------------------kPP 318
gi 6686178  280 ---------KIDEKVCKDEIRNMGi---------------qTIPEIKPEISITSND------------------------ 311
gi 18313106 278 ---------KAAGEKAETPQQPPPQ---------------------QP---VPQQ------------------------- 299
gi 17545558 310 ---------EVDDSVSADVLEGVDwetedglataftrrygddwrycslwgkwlvwtgvrwnpdqllyithlsrgicraas 380
gi 17547948 314 sdesvwgtedalalaftrryhrdwryvaawgrwlvwdghrwrtedtlaatdlirnvcrhaalhaenprlaaklatsgtia 393
gi 6686208  278 ---------EAEQAIAKNVIAKEE----------------------KP----IQS------------------------- 297
gi 13540987 293 T--------NHNSEQKKEVLEEP----------------------EAEKNEVLEQG------------------------ 318
gi 16082482 293 Gs-----QPNNNHEAKAEVIEEPP--------------------EQPPKNEEIRE------------------------- 322
gi 15790701 321 ---------AATDGSATPAPTPEP----------------------APDTAPSPD------------------------- 344
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 498 SLARSTLVKGGRqggaahaplretaivLTLlNHPRLIEEDFETLAALDLGHDAlkTLHLAMLDVLaagrvdDG-IAMRRA 576
gi 6686253  319 EEKPPTVKFTIP--------------------------KAVLEAAKELRGTLE--AIVYDKEWRE------LDrLKVREL 364
gi 6686178  312 DVEVSSVECNPS---------------NNE--ELPPKYNKYRKFYEKLIELED--SKVLIINGDK------EEiVSIEEL 366
gi 18313106 300 EVREEAQKPAFP--------------------------FDITKKIDEMLGTLE--AEIYDENWTL------VKrLPVREL 345
gi 17545558 381 fkaetprqkaklassstiasvekiarsdpkhaatadewdadvwalntpggvvdlrtgqlrahrredrmtkvttatpkgdc 460
gi 17547948 394 gverlaradrrhaattsewdadpwllntpggvvdlrtgrqrphdrddrmtkittatpvgdcptwrqflaevtggdvelqa 473
gi 6686208  298 ETTQQVVQITLP--------------------------QNILEEIKKLPGTLE--GVLYDNNWNL------IEkVQVRDI 343
gi 13540987 319 EVTQQVSVPKEG-------------------YLDLLNPHDVSRRIEALSQLKT--TEIYDSNGQR------IAsFPVAEA 371
gi 16082482 323 EQSQQVTVQKEG-------------------FLDLLNPHEVSKRIEALAQLKM--TEVYDSNGER------IFsFPVSEA 375
gi 15790701 345 SDGDDTEAAAPP---------------------------TLAEHARAVADTET--ARLLDDALAR------IReVPAAEV 389
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17986813 577 LVdaghgdLIKMLEQVVKGAKLWTATTLaaeddaREALRQALHLHQRARTLHKELRAVEAALetdetGELFARLRDIQNQ 656
gi 6686253  365 YD------YISKSEPGRIYAVVFDGIIT------QRLLDIASEKGVGIIIGNRIGNKITHKP-----TNVKFLTFSDLF- 426
gi 6686178  367 IN------NTDNYKSID--AIIINGTVT------QKLIDILYEK--TNLIFCKDA-KIIKKP-----VNLTLITFGDLNA 424
gi 18313106 346 PD------FLTTSGDS-IYAIILDGITT------QRIVDLAAKKGVKIIVTARTG-PLTKVP-----ENMQILTFDQLKK 406
gi 17545558 461 ptwrqflsevtggdvelqaylqrmagyaltgstqehalfflygtgangksvfvntlatilgdyavnaamdtfmetradrh 540
gi 17547948 474 ylqrmagyaltgstqehalfflygtgangksvfvntlatilgdyaanaamdtfmetradrhptdmaglrgarfvaaiete 553
gi 6686208  344 IP------KLEAYEDNKVAYIIFDGVIT------QRLLDLASQKNIKMIIGARIG-GINKRP-----QNVDILTFTDIIS 405
gi 13540987 372 VD------RIIQDPQGN--TIVTGGIIS------QRLIDVAYNAGIKNIYGLKLG-HITKKP-----VDINVIAWDRST- 430
gi 16082482 376 VE------RISQDPRGN--TIVTGGIIS------QRLIDVSYNAGIKNIYGLKLG-HITKKP-----VDINVIAWERSL- 434
gi 15790701 390 VD------AVADADSVP-AVVVVDATIT------QRLLDVAAQRGVASLIGADTD-EFVKQP-----LATRVRTLDDART 450

                .
gi 17986813 657 I 657
gi 6686253      -
gi 6686178      -
gi 18313106 407 V 407
gi 17545558 541 p 541
gi 17547948 554 q 554
gi 6686208  406 S 406
gi 13540987     -
gi 16082482     -
gi 15790701     -
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap