Conserved Protein Domain Family
CaiC

?
COG0318: CaiC 
Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 223395
View PSSM: COG0318
Aligned: 257 rows
Threshold Bit Score: 70.1828
Threshold Setting Gi: 11498175
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667    82 PNSIDRRHSIYRVTTINSTSANNTPRRRSKRYTASLQsslpgssdengsvkdavyNPMIPLLPRHTGAENTSSGDSAmtd 161
gi 730334     19 EPLHISEKQPATIPEVLYRTATELGDTKGIIYLQPDGte---------------vYQSYRRLWDDGLRIAKGLRQSG--- 80
gi 20089903    1 ----------MRIDAYISEYARKTPQSVALEDSKNS--------------------VSYGCLEKDISNIALYLKDFK--- 47
gi 15839412    1 -----------MTAALLSPAIAWQQISACTDRTLTITced-------------seVISYQDLIARAAACIPPLRRLDl-- 54
gi 15840441    1 --------------------MFHNARTATTG--MVTGeph------------mpvRHTWGEVHERARCIAGGLAAAGv-- 44
gi 15840800      --------------------------------------------------------------------------------
gi 17549638   12 HVQEADHFPSLTTSDLLLQAAYRYPESGLRFVDDHGAge--------------vdCLSYFKLLQEAKCILAELRVLG--- 74
gi 15607177    1 -----------MTAALLSPAIAWQQISACTDRTLTITced-------------seVISYQDLIARAAACIPPLRRLDl-- 54
gi 15608153    1 -------------MSRFTEKMFHNARTATTG--MVTGeph------------mpvRHTWGEVHERARCIAGGLAAAGv-- 51
gi 1723051     1 -------------MSELAAVLTR-SMQASAGDLMVLDrets-----------lwcRHPWPEVHGLAESVAAWLLDHDr-- 53
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   162 slplILRGRFehydgqTAMISINSkgketfitwdklylkaervahelnkshlykmdkillwynkndvIEFTIALLGCFIs 241
gi 730334     81 ----LKAKQS------WILQLGDN-------------------------------------------SQLLPAFWGCVL- 106
gi 20089903   48 -------RSR------FTILAESD-------------------------------------------IQYVKLLLAVYR- 70
gi 15839412   55 ------kRGEp-----VLITAHTN-------------------------------------------LEFLSCFLGLML- 79
gi 15840441   45 ------gLGDvv---gVLAGFP---------------------------------------------VEIAPTAQALWM- 69
gi 15840800    1 ---------------mgLVGEPT--------------------------------------------VELVAAIQGAWL- 20
gi 17549638   75 ----RRPGDK------VVLLLERA-------------------------------------------RDFVPAFWACVL- 100
gi 15607177   55 ------kRGEp-----VLITAHTN-------------------------------------------LEFLSCFLGLML- 79
gi 15608153   52 ------gLGDvv---gVLAGFP---------------------------------------------VEIAPTAQALWM- 76
gi 1723051    54 --------PAav----gLVGEPT--------------------------------------------VELVAAIQGAWL- 76
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   242 gMAAVPVSFETYSlreileiikvTNSKFVLISNAChrQLDNLYSSSNhsKVKLVKNDVFQQikfvktddLGTYTKAKKTS 321
gi 730334    107 -TGVVPAPLAVPP----------TYAESSSGTQKLk-DAWTLLDKPAviTDRGMHQEMLDWak-----eQGLEGFRAIIV 169
gi 20089903   71 -SENIAIPLPIEF----------PRFSLERILDSA--HVNNIITTDTqySRFGKSFFERFG--------TVVVTYNDMSV 129
gi 15839412   80 -HGAVPVPIPPREal------ktTERFMTRLGPLLrhHRVLICTPAE--HDEIRAAASTDC--------QISRFTALAEA 142
gi 15840441   70 -RGASLTMLHQPTpr------tdLAVWAEDTMTVI--GMIEAKAVIV--SEPFLVAIP---------------ILEQKGM 123
gi 15840800   21 -AGAAVSILPGPVrg------anDQRWADATLTRF--LGIGVRTVLS--QGSYLARLR---------------SVDTAGV 74
gi 17549638  101 -GGVIPCPVAPIRh---------DPMRWQKTLEHI----DALLDSPL--FITTHTLKAGLP---------DTMEVVTLDA 155
gi 15607177   80 -HGAVPVPIPPREal------ktTERFMTRLGPLLrhHRVLICTPAE--HDEIRAAASTDC--------QISRFTALAEA 142
gi 15608153   77 -RGASLTMLHQPTpr------tdLAVWAEDTMTVI--GMIEAKAVIV--SEPFLVAIP---------------ILEQKGM 130
gi 1723051    77 -AGAAVSILPGPVrg------anDQRWADATLTRF--LGIGVRTVLS--QGSYLARLR---------------SVDTAGV 130
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   322 PTFDIPnisyieftrtplgrlsgvvmkhnilinqfetmtkILNSRsMPHWkqKSQSIRKpfhkkIMATNSRFVILnSLDp 401
gi 730334    170 EDLLS-----------------------------------AEADT--------DWHQS-------SPEDLALLLL-TSG- 197
gi 20089903  130 NILR--------------------------------------KEI-KDE--------TN-------NPELRLVLY-TSG- 153
gi 15839412  143 GDEQFG----------------------------------RATAQ-QLAD--TA--TADwp--lCTLDDDAYVQY-TSG- 179
gi 15840441  124 QVLTVA----------------------------------DLLAS-DP---------IGpi--eVGEDDLALMQL-TSG- 155
gi 15840800   75 TIGDLS----------------------------------TAAHT-N----------RSat--pVASEGPAVLQG-TAG- 105
gi 17549638  156 LRHAH-----------------------------------SVSPL---------VPVHP-----ARVNDPAVFVL-TSG- 184
gi 15607177  143 GDEQFG----------------------------------RATAQ-QLAD--TA--TADwp--lCTLDDDAYVQY-TSG- 179
gi 15608153  131 QVLTVA----------------------------------DLLAS-DP---------IGpi--eVGEDDLALMQL-TSG- 162
gi 1723051   131 TIGDLS----------------------------------TAAHT-N----------RSat--pVASEGPAVLQG-TAG- 161
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   402 trSTGLIMGVLFnlfTGNLMISIdssilqrpggyeniidkfradillndQLQLKQVVINYlenpesafskkhkidfscik 481
gi 730334    198 --STGTPKAVML---NHRNIMSM--------------------------VKGIIQMQG---------------------- 224
gi 20089903  154 --TTGTPKGVML---SDRNLIAN--------------------------GESIIGVLG---------------------- 180
gi 15839412  180 --STAAPRGVVI---TYRNLLSNm-------------------------RAMAVGSQFQH-------------------- 209
gi 15840441  156 --STGSPKAVQI---THRNIYSNa-------------------------EAMFVGAQYDV-------------------- 185
gi 15840800  106 --STGAPRTAIL---SPGAVLSNl-------------------------RGLNQRVGTDA-------------------- 135
gi 17549638  185 --STGNSKAVVL---THGNLLAS--------------------------MAGKNGYQR---------------------- 211
gi 15607177  180 --STAAPRGVVI---TYRNLLSNm-------------------------RAMAVGSQFQH-------------------- 209
gi 15608153  163 --STGSPKAVQI---THRNIYSNa-------------------------EAMFVGAQYDV-------------------- 192
gi 1723051   162 --STGAPRTAIL---SPGAVLSNl-------------------------RGLNQRVGTDA-------------------- 191
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   482 sclTSCTTIdtdvsEMVVHKWLKNLGCIDApfcyspmLTLLDFGGIFIsirdqlgnlenfpihnskLRLQNELFINREKL 561
gi 730334    225 ---FTREDI-----TFNWMPFDHVGGIGML-------HLRDVYLGCQE------------------INVSSETILMEPLK 271
gi 20089903  181 ---ITSEDK-----GALVISPHHAFGNSIL-------NSHLMAGGSVR------------------IG----TMNFMNSV 223
gi 15839412  210 ---GDVMG-------S-WLPLHHDMGLVGS-------LFAALFNSVSA------------------VFTTPHRFLYDPLG 253
gi 15840441  186 ---DKDVM-------VSWLPCFHDMGMVGF-------LTIPMFFGAEL------------------VKVTPMDFLRDTLL 230
gi 15840800  136 ---ATDVG-------CSWLPLYHDMGLA-F-------VLSAALAGAPL------------------WLAPTTAFTASPFR 179
gi 17549638  212 ---LGSDDV-----TLNWISFDHVAALLEA-------HLLPLSVGAAQ------------------IHVDSAPILSDPLL 258
gi 15607177  210 ---GDVMG-------S-WLPLHHDMGLVGS-------LFAALFNSVSA------------------VFTTPHRFLYDPLG 253
gi 15608153  193 ---DKDVM-------VSWLPCFHDMGMVGF-------LTIPMFFGAEL------------------VKVTPMDFLRDTLL 237
gi 1723051   192 ---ATDVG-------CSWLPLYHDMGLA-F-------VLSAALAGAPL------------------WLAPTTAFTASPFR 235
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   562 KLNEVECsitaminssssfkdylkletfgfpipditlCVVNPDTNTLVQDlTVGEIWISsnhitdefyqmdkvnefvfka 641
gi 730334    272 WLDWIDHy-----------------------------RASVTWAPNFAFGlVTDFAEEI--------------------- 301
gi 20089903  224 FNLIGSG------------------------------VSIFYGVPSTYRM-LLKYPDRF--------------------- 251
gi 15839412  254 FLRLLTs-----------------------------sGATHTFMPNFALE-WLINAYHR--------------------- 282
gi 15840441  231 WAKLIDk-----------------------------yQGTMTAAPNFAYA-LLAKRLRR--------------------- 259
gi 15840800  180 WLSWLSd-----------------------------sGATMTAAPNFAYN-LIGKYARR--------------------- 208
gi 17549638  259 FLRLISDh-----------------------------RVSMTFAPNFLFGqINAALQAK--------------------- 288
gi 15607177  254 FLRLLTs-----------------------------sGATHTFMPNFALE-WLINAYHR--------------------- 282
gi 15608153  238 WAKLIDk-----------------------------yQGTMTAAPNFAYA-LLAKRLRR--------------------- 266
gi 1723051   236 WLSWLSd-----------------------------sGATMTAAPNFAYN-LIGKYARR--------------------- 264
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   642 KLNYSEmfswakyEMPTNEKSQAVteqldtilnicpantyfmrtklmgfvhngkiyvlslIEDMFLQNRLIRLPNwahts 721
gi 730334    302 KDKKWDl-----sSMRYMLNGGEA------------------------------------MVAKVGRRILELLEP----- 335
gi 20089903  252 RQVFTG--------VRTAASAGGG------------------------------------MDRSIVKEIRELAPW----- 282
gi 15839412  283 RGADIEgid--lhKMRRLIIASEP------------------------------------VHAEGMRRFAATFAG----- 319
gi 15840441  260 QAKPGdfd---lsTLRFALSGAEP------------------------------------VEPADVEDLLDAGKP----- 295
gi 15840800  209 VSevd------lgALRVTLNGGEP------------------------------------VDCDGLTRFAEAMAP----- 241
gi 17549638  289 DAQAQAkhsfnlsRLRHIISGGEA------------------------------------VVVETGHRFIELLAP----- 327
gi 15607177  283 RGADIEgid--lhKMRRLIIASEP------------------------------------VHAEGMRRFAATFAG----- 319
gi 15608153  267 QAKPGdfd---lsTLRFALSGAEP------------------------------------VEPADVEDLLDAGKP----- 302
gi 1723051   265 VSevd------lgALRVTLNGGEP------------------------------------VDCDGLTRFAEAMAP----- 297
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   722 nllyakkgnqsaqpkgntgaestkaidIsslsgETSSGYKrvveshylqqITETVvrtvntvfevaafelqhhkeehflv 801
gi 730334    336 ---------------------------HglpadAIRPAWG----------MSETS------------------------- 353
gi 20089903  283 ---------------------------L-----EILPMYG----------QTEAT------------------------- 295
gi 15839412  320 ---------------------------VglaptALGSGYG----------LAEAT------------------------- 337
gi 15840441  296 ---------------------------FglrpsAILPAYG----------MAETT------------------------- 313
gi 15840800  242 ---------------------------FgfdagAVLPSYG----------LAEST------------------------- 259
gi 17549638  328 ---------------------------YglvasALWPAFG----------MSETC------------------------- 345
gi 15607177  320 ---------------------------VglaptALGSGYG----------LAEAT------------------------- 337
gi 15608153  303 ---------------------------FglrpsAILPAYG----------MAETT------------------------- 320
gi 1723051   298 ---------------------------FgfdagAVLPSYG----------LAEST------------------------- 315
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   802 mvveSSLAKTEEESkNgettdttlmkfaetqrnklETKMNDLtdqifRilwifhkiqpmcilvvprdtlprrycslelan 881
gi 730334    354 ----SGVIFSHEFTr--------------------AGTSDDDhfveiG-------------------------------- 377
gi 20089903  296 ----ARLAYVPAEDv--------------------DKFIDTIg------------------------------------- 314
gi 15839412  338 -----VAVSMSAPNtGfrtet---------haaaeVVTGGRVlp------------------------------------ 367
gi 15840441  314 -----LAVSFSECNaGlvvde---------vdadlLAALRRAvpatkGnt------------------------------ 349
gi 15840800  260 -----CAVTVPVPGiGlladr----------vidgSGAHKHAv---lGnpi----------------------------- 292
gi 17549638  346 ----AGSIYSRNFPdGd------------------QRREFASl----G-------------------------------- 367
gi 15607177  338 -----VAVSMSAPNtGfrtet---------haaaeVVTGGRVlp------------------------------------ 367
gi 15608153  321 -----LAVSFSECNaGlvvde---------vdadlLAALRRAvpatkGnt------------------------------ 356
gi 1723051   316 -----CAVTVPVPGiGlladr----------vidgSGAHKHAv---lGnpi----------------------------- 348
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   882 stvekkflnndlsaqfvkfqfdnvildflphsayynesilsehlsklrkmalqeeyamiepayrnggpvkpklalqcsgv 961
gi 730334        --------------------------------------------------------------------------------
gi 20089903      --------------------------------------------------------------------------------
gi 15839412      --------------------------------------------------------------------------------
gi 15840441      --------------------------------------------------------------------------------
gi 15840800      --------------------------------------------------------------------------------
gi 17549638      --------------------------------------------------------------------------------
gi 15607177      --------------------------------------------------------------------------------
gi 15608153      --------------------------------------------------------------------------------
gi 1723051       --------------------------------------------------------------------------------
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667   962 dyrdesvdtrshtkltdfksiLEILEwrisnygnetafsdgTNTNLVNSSASndNnvhkkvswasfgkivagfLKKivgs 1041
gi 730334    378 ---------------------SPIPG---------------FSMRIVNDHNElvE------------------EGE---- 399
gi 20089903  315 ---------------------KAIPG---------------VTLDVFDFECR--S------------------VEPn--- 335
gi 15839412  368 ----------------------------------------gYEVRIDA-------------------------------- 375
gi 15840441  350 -------------------rrLATLGpll----------qdLEARIID-EQ----------------------GDV---- 373
gi 15840800  293 ---------------------------------------pgMEVRISCGDQ----------------------AAG---- 307
gi 17549638  368 ---------------------YPVAG---------------LQIRVVDESG---A------------------PLPd--- 387
gi 15607177  368 ----------------------------------------gYEVRIDA-------------------------------- 375
gi 15608153  357 -------------------rrLATLGpll----------qdLEARIID-EQ----------------------GDV---- 380
gi 1723051   349 ---------------------------------------pgMEVRISCGDQ----------------------AAG---- 363
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1042 kiplkhgdpiiimceNSveyVAMimaclycnlLVIPlpsvKESVIEEDLKGlvniiqsykvkrvfvdaklhsllndnnvv 1121
gi 730334    400 --------------------IGR---------FQVS----GLSVTSGYYQR----------------------------- 417
gi 20089903  336 -------------------iEGE---------LVAR----GENILIGYLDD----------------------------- 354
gi 15839412  376 ---------------APgarAGT---------IKLR----GDSVAAKAYVG----------------------------- 398
gi 15840441  374 ---------------MPargVGV---------IELR----GESLTPGYLTM----------------------------- 396
gi 15840800  308 ---------------NAsreIGE---------IEIR----GASMMAGYL------------------------------- 328
gi 17549638  388 ---------------GE---TGE---------LQLR----GPMVFGHYHKN----------------------------- 407
gi 15607177  376 ---------------APgarAGT---------IKLR----GDSVAAKAYVG----------------------------- 398
gi 15608153  381 ---------------MPargVGV---------IELR----GESLTPGYLTM----------------------------- 403
gi 1723051   364 ---------------NAsreIGE---------IEIR----GASMMAGYL------------------------------- 384
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1122 nkcfkkyksliPKITVFsKVKTknaltvsmfknvlkqkfgakpgtrigmtpcvvwvnteydvtsnihvtmthssllnask 1201
gi 730334    418 -----------PDLNES-VFTEd--------------------------------------------------------- 428
gi 20089903  355 -----------EIATKSkVVN----------------------------------------------------------- 364
gi 15839412  399 -----------GKKLDAld------------------------------------------------------------- 406
gi 15840441  397 -----------GGFIPAqd------------------------------------------------------------- 404
gi 15840800  329 ------------GQQPid-------------------------------------------------------------- 334
gi 17549638  408 -----------EEATRQ-AFTEd--------------------------------------------------------- 418
gi 15607177  399 -----------GKKLDAld------------------------------------------------------------- 406
gi 15608153  404 -----------GGFIPAqd------------------------------------------------------------- 411
gi 1723051   385 ------------GQQPid-------------------------------------------------------------- 390
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1202 ivketlqlrnnsPLFsicshtsglgfmfscllgIYTGASTcLFSLTdvltdpkefliGLqnlnvkdlylkletlYALLDR 1281
gi 730334    429 -------------GW------------------FETGDLG--FLRN-----------GR---------------LTITGR 449
gi 20089903  365 -------------GW------------------LHTGDLA-QKLPN-----------GY---------------IRLLGR 386
gi 15839412  407 -----------eEGF------------------CDTHDL--GFLVDd--------------------------eIVILGR 429
gi 15840441  405 -----------eHGW------------------YDTGDL--GYLTEeg-------------------------hVVVCGR 428
gi 15840800  335 -----------pDDW------------------FATGDL--GYLGAg--------------------------gLVVCGR 357
gi 17549638  419 -------------GW------------------FRSGDLG-QIHG------------GQ---------------LRLVGR 439
gi 15607177  407 -----------eEGF------------------CDTHDL--GFLVDd--------------------------eIVILGR 429
gi 15608153  412 -----------eHGW------------------YDTGDL--GYLTEeg-------------------------hVVVCGR 435
gi 1723051   391 -----------pDDW------------------FATGDL--GYLGAg--------------------------gLVVCGR 413
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1282 aSSliegfknkkENINSAKNNTSGSLREDVFKGVRnimipfpnrpriytienilkrystislsctqisyvyqhhfnpLIS 1361
gi 730334    450 -TK---------DAIIINGINYYSHAIESAVEELPe----------------------------------------iETS 479
gi 20089903  387 -KD---------DIIKIGDHRVNPREIERYIEENN------------------------------------------TVS 414
gi 15839412  430 -QD---------EVFIVHGENRFPYDIEFIIRGESe------------------------------------------QH 457
gi 15840441  429 -VK---------DVIIMAGRNIYPTDIERAAGRVDg----------------------------------------vRPG 458
gi 15840800  358 -AK---------EVISIAGRNIFPTEVELVAAQVRg----------------------------------------vREG 387
gi 17549638  440 -SK---------DSIVVSGANYFSHELEVALEQLD------------------------------------------GIE 467
gi 15607177  430 -QD---------EVFIVHGENRFPYDIEFIIRGESe------------------------------------------QH 457
gi 15608153  436 -VK---------DVIIMAGRNIYPTDIERAAGRVDg----------------------------------------vRPG 465
gi 1723051   414 -AK---------EVISIAGRNIFPTEVELVAAQVRg----------------------------------------vREG 443
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1362 LRSYLDIPPVdlyldpfslregiirevnpndvsagnyikiqdsgvvpvctdvsvvnpetllpcVDGEFGEIWCCSEANAF 1441
gi 730334    480 YTAACAVRLGq----------------------------------------------------NSTDQLAIFFVTSAKLN 507
gi 20089903  415 RVFVVPVSHE-----------------------------------------------------LMGTAISLMVMPAEGt- 440
gi 15839412  458 RTKVACFG--------------------------------------------------------VNERVVVVLES--PLD 479
gi 15840441  459 CAVAVRLDAg-----------------------------------------------------HSRESFAVAVESNAFED 485
gi 15840800  388 AVVALGTGDr-----------------------------------------------------STRPGLVVAAEFRG-PD 413
gi 17549638  468 RSFVAAFPTR-----------------------------------------------------PKGVDTELLVVIFATTI 494
gi 15607177  458 RTKVACFG--------------------------------------------------------VNERVVVVLES--PLD 479
gi 15608153  466 CAVAVRLDAg-----------------------------------------------------HSRESFAVAVESNAFED 492
gi 1723051   444 AVVALGTGDr-----------------------------------------------------STRPGLVVAAEFRG-PD 469
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6324667  1442 dyfvcnssknklykdpfitEQFkskmkSEVNNTLSYLRtgdlgfiknvsctnsqgevvnlnlLFVLGSIHESIEILglth 1521
gi 730334    508 --------------------DE-----QMSQLLRNIQSh----------------------vSQVIGVTPEYLLPVq--- 537
gi 20089903  441 ---------------------------EIEALYAFCRK------------------------NFPGYLCPREILFI---- 465
gi 15839412  480 si----------------iDKA-----EADRLRCQVVA------------------------ATGLQLDELITVRR---- 510
gi 15840441  486 pa----------------eVRR-----IEHQVAHEVVA------------------------EVDVRPRNVVVLGP---- 516
gi 15840800  414 ea----------------nAR--------AELIQRVAS------------------------ECGIVPSDVVFVSP---- 441
gi 17549638  495 pl----------------nDEA-----RLHQLNVAIRNt----------------------tILLWGFRPALILPLp--- 528
gi 15607177  480 si----------------iDKA-----EADRLRCQVVA------------------------ATGLQLDELITVRR---- 510
gi 15608153  493 pa----------------eVRR-----IEHQVAHEVVA------------------------EVDVRPRNVVVLGP---- 523
gi 1723051   470 ea----------------nAR--------AELIQRVAS------------------------ECGIVPSDVVFVSP---- 497
                       1450      1460      1470      1480      1490
                 ....*....|....*....|....*....|....*....|....*....|
gi 6324667  1522 fvsdlertvkdvhsdiGSCLIAKAGGLLVCLIRCKERHnpilgNLTTLIV 1571
gi 730334    538 ---------------kEEIPKTAIGKIQRTQLPIG--------------- 557
gi 20089903  466 ----------------DYIPLSENGKISNRSIIEEYQH-----VKSSM-- 492
gi 15839412  511 ----------------GAIPTTTSGKLKRRAVAQAYRDg---tLPRLATH 541
gi 15840441  517 ----------------GTIPKTPSGKLRRAN---SVTLvt---------- 537
gi 15840800  442 ----------------GSLPRTSSGKLRRLAVRRSLEMad---------- 465
gi 17549638  529 ---------------kTDFPKTSLGKIQRATLRKRLENgefseTIAYIEK 563
gi 15607177  511 ----------------GAIPTTTSGKLKRRAVAQAYRDg---tLPRLATH 541
gi 15608153  524 ----------------GTIPKTPSGKLRRAN---SVTLvt---------- 544
gi 1723051   498 ----------------GSLPRTSSGKLRRLAVRRSLEMad---------- 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap