Conserved Protein Domain Family
CaiC

?
COG0318: CaiC 
Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 223395
View PSSM: COG0318
Aligned: 257 rows
Threshold Bit Score: 70.1828
Threshold Setting Gi: 11498175
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6324667    82 PNSIDRRHSIYRVTTINSTSANNTPRRRSKRYTASLQsslpgssdengsvkdavyNPMIPLLPRHTGAENTSSGDSAmtd 161  baker's yeast
730334     19 EPLHISEKQPATIPEVLYRTATELGDTKGIIYLQPDGte---------------vYQSYRRLWDDGLRIAKGLRQSG--- 80   Bacillus subtilis
20089903    1 ----------MRIDAYISEYARKTPQSVALEDSKNS--------------------VSYGCLEKDISNIALYLKDFK--- 47   Methanosarcina ac...
15839412    1 -----------MTAALLSPAIAWQQISACTDRTLTITced-------------seVISYQDLIARAAACIPPLRRLDl-- 54   Mycobacterium tub...
15840441    1 --------------------MFHNARTATTG--MVTGeph------------mpvRHTWGEVHERARCIAGGLAAAGv-- 44   Mycobacterium tub...
15840800      -------------------------------------------------------------------------------- Mycobacterium tub...
17549638   12 HVQEADHFPSLTTSDLLLQAAYRYPESGLRFVDDHGAge--------------vdCLSYFKLLQEAKCILAELRVLG--- 74   Ralstonia solanac...
15607177    1 -----------MTAALLSPAIAWQQISACTDRTLTITced-------------seVISYQDLIARAAACIPPLRRLDl-- 54   Mycobacterium tub...
15608153    1 -------------MSRFTEKMFHNARTATTG--MVTGeph------------mpvRHTWGEVHERARCIAGGLAAAGv-- 51   Mycobacterium tub...
1723051     1 -------------MSELAAVLTR-SMQASAGDLMVLDrets-----------lwcRHPWPEVHGLAESVAAWLLDHDr-- 53   Mycobacterium tub...
6324667   162 slplILRGRFehydgqTAMISINSkgketfitwdklylkaervahelnkshlykmdkillwynkndvIEFTIALLGCFIs 241  baker's yeast
730334     81 ----LKAKQS------WILQLGDN-------------------------------------------SQLLPAFWGCVL- 106  Bacillus subtilis
20089903   48 -------RSR------FTILAESD-------------------------------------------IQYVKLLLAVYR- 70   Methanosarcina ac...
15839412   55 ------kRGEp-----VLITAHTN-------------------------------------------LEFLSCFLGLML- 79   Mycobacterium tub...
15840441   45 ------gLGDvv---gVLAGFP---------------------------------------------VEIAPTAQALWM- 69   Mycobacterium tub...
15840800    1 ---------------mgLVGEPT--------------------------------------------VELVAAIQGAWL- 20   Mycobacterium tub...
17549638   75 ----RRPGDK------VVLLLERA-------------------------------------------RDFVPAFWACVL- 100  Ralstonia solanac...
15607177   55 ------kRGEp-----VLITAHTN-------------------------------------------LEFLSCFLGLML- 79   Mycobacterium tub...
15608153   52 ------gLGDvv---gVLAGFP---------------------------------------------VEIAPTAQALWM- 76   Mycobacterium tub...
1723051    54 --------PAav----gLVGEPT--------------------------------------------VELVAAIQGAWL- 76   Mycobacterium tub...
6324667   242 gMAAVPVSFETYSlreileiikvTNSKFVLISNAChrQLDNLYSSSNhsKVKLVKNDVFQQikfvktddLGTYTKAKKTS 321  baker's yeast
730334    107 -TGVVPAPLAVPP----------TYAESSSGTQKLk-DAWTLLDKPAviTDRGMHQEMLDWak-----eQGLEGFRAIIV 169  Bacillus subtilis
20089903   71 -SENIAIPLPIEF----------PRFSLERILDSA--HVNNIITTDTqySRFGKSFFERFG--------TVVVTYNDMSV 129  Methanosarcina ac...
15839412   80 -HGAVPVPIPPREal------ktTERFMTRLGPLLrhHRVLICTPAE--HDEIRAAASTDC--------QISRFTALAEA 142  Mycobacterium tub...
15840441   70 -RGASLTMLHQPTpr------tdLAVWAEDTMTVI--GMIEAKAVIV--SEPFLVAIP---------------ILEQKGM 123  Mycobacterium tub...
15840800   21 -AGAAVSILPGPVrg------anDQRWADATLTRF--LGIGVRTVLS--QGSYLARLR---------------SVDTAGV 74   Mycobacterium tub...
17549638  101 -GGVIPCPVAPIRh---------DPMRWQKTLEHI----DALLDSPL--FITTHTLKAGLP---------DTMEVVTLDA 155  Ralstonia solanac...
15607177   80 -HGAVPVPIPPREal------ktTERFMTRLGPLLrhHRVLICTPAE--HDEIRAAASTDC--------QISRFTALAEA 142  Mycobacterium tub...
15608153   77 -RGASLTMLHQPTpr------tdLAVWAEDTMTVI--GMIEAKAVIV--SEPFLVAIP---------------ILEQKGM 130  Mycobacterium tub...
1723051    77 -AGAAVSILPGPVrg------anDQRWADATLTRF--LGIGVRTVLS--QGSYLARLR---------------SVDTAGV 130  Mycobacterium tub...
6324667   322 PTFDIPnisyieftrtplgrlsgvvmkhnilinqfetmtkILNSRsMPHWkqKSQSIRKpfhkkIMATNSRFVILnSLDp 401  baker's yeast
730334    170 EDLLS-----------------------------------AEADT--------DWHQS-------SPEDLALLLL-TSG- 197  Bacillus subtilis
20089903  130 NILR--------------------------------------KEI-KDE--------TN-------NPELRLVLY-TSG- 153  Methanosarcina ac...
15839412  143 GDEQFG----------------------------------RATAQ-QLAD--TA--TADwp--lCTLDDDAYVQY-TSG- 179  Mycobacterium tub...
15840441  124 QVLTVA----------------------------------DLLAS-DP---------IGpi--eVGEDDLALMQL-TSG- 155  Mycobacterium tub...
15840800   75 TIGDLS----------------------------------TAAHT-N----------RSat--pVASEGPAVLQG-TAG- 105  Mycobacterium tub...
17549638  156 LRHAH-----------------------------------SVSPL---------VPVHP-----ARVNDPAVFVL-TSG- 184  Ralstonia solanac...
15607177  143 GDEQFG----------------------------------RATAQ-QLAD--TA--TADwp--lCTLDDDAYVQY-TSG- 179  Mycobacterium tub...
15608153  131 QVLTVA----------------------------------DLLAS-DP---------IGpi--eVGEDDLALMQL-TSG- 162  Mycobacterium tub...
1723051   131 TIGDLS----------------------------------TAAHT-N----------RSat--pVASEGPAVLQG-TAG- 161  Mycobacterium tub...
6324667   402 trSTGLIMGVLFnlfTGNLMISIdssilqrpggyeniidkfradillndQLQLKQVVINYlenpesafskkhkidfscik 481  baker's yeast
730334    198 --STGTPKAVML---NHRNIMSM--------------------------VKGIIQMQG---------------------- 224  Bacillus subtilis
20089903  154 --TTGTPKGVML---SDRNLIAN--------------------------GESIIGVLG---------------------- 180  Methanosarcina ac...
15839412  180 --STAAPRGVVI---TYRNLLSNm-------------------------RAMAVGSQFQH-------------------- 209  Mycobacterium tub...
15840441  156 --STGSPKAVQI---THRNIYSNa-------------------------EAMFVGAQYDV-------------------- 185  Mycobacterium tub...
15840800  106 --STGAPRTAIL---SPGAVLSNl-------------------------RGLNQRVGTDA-------------------- 135  Mycobacterium tub...
17549638  185 --STGNSKAVVL---THGNLLAS--------------------------MAGKNGYQR---------------------- 211  Ralstonia solanac...
15607177  180 --STAAPRGVVI---TYRNLLSNm-------------------------RAMAVGSQFQH-------------------- 209  Mycobacterium tub...
15608153  163 --STGSPKAVQI---THRNIYSNa-------------------------EAMFVGAQYDV-------------------- 192  Mycobacterium tub...
1723051   162 --STGAPRTAIL---SPGAVLSNl-------------------------RGLNQRVGTDA-------------------- 191  Mycobacterium tub...
6324667   482 sclTSCTTIdtdvsEMVVHKWLKNLGCIDApfcyspmLTLLDFGGIFIsirdqlgnlenfpihnskLRLQNELFINREKL 561  baker's yeast
730334    225 ---FTREDI-----TFNWMPFDHVGGIGML-------HLRDVYLGCQE------------------INVSSETILMEPLK 271  Bacillus subtilis
20089903  181 ---ITSEDK-----GALVISPHHAFGNSIL-------NSHLMAGGSVR------------------IG----TMNFMNSV 223  Methanosarcina ac...
15839412  210 ---GDVMG-------S-WLPLHHDMGLVGS-------LFAALFNSVSA------------------VFTTPHRFLYDPLG 253  Mycobacterium tub...
15840441  186 ---DKDVM-------VSWLPCFHDMGMVGF-------LTIPMFFGAEL------------------VKVTPMDFLRDTLL 230  Mycobacterium tub...
15840800  136 ---ATDVG-------CSWLPLYHDMGLA-F-------VLSAALAGAPL------------------WLAPTTAFTASPFR 179  Mycobacterium tub...
17549638  212 ---LGSDDV-----TLNWISFDHVAALLEA-------HLLPLSVGAAQ------------------IHVDSAPILSDPLL 258  Ralstonia solanac...
15607177  210 ---GDVMG-------S-WLPLHHDMGLVGS-------LFAALFNSVSA------------------VFTTPHRFLYDPLG 253  Mycobacterium tub...
15608153  193 ---DKDVM-------VSWLPCFHDMGMVGF-------LTIPMFFGAEL------------------VKVTPMDFLRDTLL 237  Mycobacterium tub...
1723051   192 ---ATDVG-------CSWLPLYHDMGLA-F-------VLSAALAGAPL------------------WLAPTTAFTASPFR 235  Mycobacterium tub...
6324667   562 KLNEVECsitaminssssfkdylkletfgfpipditlCVVNPDTNTLVQDlTVGEIWISsnhitdefyqmdkvnefvfka 641  baker's yeast
730334    272 WLDWIDHy-----------------------------RASVTWAPNFAFGlVTDFAEEI--------------------- 301  Bacillus subtilis
20089903  224 FNLIGSG------------------------------VSIFYGVPSTYRM-LLKYPDRF--------------------- 251  Methanosarcina ac...
15839412  254 FLRLLTs-----------------------------sGATHTFMPNFALE-WLINAYHR--------------------- 282  Mycobacterium tub...
15840441  231 WAKLIDk-----------------------------yQGTMTAAPNFAYA-LLAKRLRR--------------------- 259  Mycobacterium tub...
15840800  180 WLSWLSd-----------------------------sGATMTAAPNFAYN-LIGKYARR--------------------- 208  Mycobacterium tub...
17549638  259 FLRLISDh-----------------------------RVSMTFAPNFLFGqINAALQAK--------------------- 288  Ralstonia solanac...
15607177  254 FLRLLTs-----------------------------sGATHTFMPNFALE-WLINAYHR--------------------- 282  Mycobacterium tub...
15608153  238 WAKLIDk-----------------------------yQGTMTAAPNFAYA-LLAKRLRR--------------------- 266  Mycobacterium tub...
1723051   236 WLSWLSd-----------------------------sGATMTAAPNFAYN-LIGKYARR--------------------- 264  Mycobacterium tub...
6324667   642 KLNYSEmfswakyEMPTNEKSQAVteqldtilnicpantyfmrtklmgfvhngkiyvlslIEDMFLQNRLIRLPNwahts 721  baker's yeast
730334    302 KDKKWDl-----sSMRYMLNGGEA------------------------------------MVAKVGRRILELLEP----- 335  Bacillus subtilis
20089903  252 RQVFTG--------VRTAASAGGG------------------------------------MDRSIVKEIRELAPW----- 282  Methanosarcina ac...
15839412  283 RGADIEgid--lhKMRRLIIASEP------------------------------------VHAEGMRRFAATFAG----- 319  Mycobacterium tub...
15840441  260 QAKPGdfd---lsTLRFALSGAEP------------------------------------VEPADVEDLLDAGKP----- 295  Mycobacterium tub...
15840800  209 VSevd------lgALRVTLNGGEP------------------------------------VDCDGLTRFAEAMAP----- 241  Mycobacterium tub...
17549638  289 DAQAQAkhsfnlsRLRHIISGGEA------------------------------------VVVETGHRFIELLAP----- 327  Ralstonia solanac...
15607177  283 RGADIEgid--lhKMRRLIIASEP------------------------------------VHAEGMRRFAATFAG----- 319  Mycobacterium tub...
15608153  267 QAKPGdfd---lsTLRFALSGAEP------------------------------------VEPADVEDLLDAGKP----- 302  Mycobacterium tub...
1723051   265 VSevd------lgALRVTLNGGEP------------------------------------VDCDGLTRFAEAMAP----- 297  Mycobacterium tub...
6324667   722 nllyakkgnqsaqpkgntgaestkaidIsslsgETSSGYKrvveshylqqITETVvrtvntvfevaafelqhhkeehflv 801  baker's yeast
730334    336 ---------------------------HglpadAIRPAWG----------MSETS------------------------- 353  Bacillus subtilis
20089903  283 ---------------------------L-----EILPMYG----------QTEAT------------------------- 295  Methanosarcina ac...
15839412  320 ---------------------------VglaptALGSGYG----------LAEAT------------------------- 337  Mycobacterium tub...
15840441  296 ---------------------------FglrpsAILPAYG----------MAETT------------------------- 313  Mycobacterium tub...
15840800  242 ---------------------------FgfdagAVLPSYG----------LAEST------------------------- 259  Mycobacterium tub...
17549638  328 ---------------------------YglvasALWPAFG----------MSETC------------------------- 345  Ralstonia solanac...
15607177  320 ---------------------------VglaptALGSGYG----------LAEAT------------------------- 337  Mycobacterium tub...
15608153  303 ---------------------------FglrpsAILPAYG----------MAETT------------------------- 320  Mycobacterium tub...
1723051   298 ---------------------------FgfdagAVLPSYG----------LAEST------------------------- 315  Mycobacterium tub...
6324667   802 mvveSSLAKTEEESkNgettdttlmkfaetqrnklETKMNDLtdqifRilwifhkiqpmcilvvprdtlprrycslelan 881  baker's yeast
730334    354 ----SGVIFSHEFTr--------------------AGTSDDDhfveiG-------------------------------- 377  Bacillus subtilis
20089903  296 ----ARLAYVPAEDv--------------------DKFIDTIg------------------------------------- 314  Methanosarcina ac...
15839412  338 -----VAVSMSAPNtGfrtet---------haaaeVVTGGRVlp------------------------------------ 367  Mycobacterium tub...
15840441  314 -----LAVSFSECNaGlvvde---------vdadlLAALRRAvpatkGnt------------------------------ 349  Mycobacterium tub...
15840800  260 -----CAVTVPVPGiGlladr----------vidgSGAHKHAv---lGnpi----------------------------- 292  Mycobacterium tub...
17549638  346 ----AGSIYSRNFPdGd------------------QRREFASl----G-------------------------------- 367  Ralstonia solanac...
15607177  338 -----VAVSMSAPNtGfrtet---------haaaeVVTGGRVlp------------------------------------ 367  Mycobacterium tub...
15608153  321 -----LAVSFSECNaGlvvde---------vdadlLAALRRAvpatkGnt------------------------------ 356  Mycobacterium tub...
1723051   316 -----CAVTVPVPGiGlladr----------vidgSGAHKHAv---lGnpi----------------------------- 348  Mycobacterium tub...
6324667   882 stvekkflnndlsaqfvkfqfdnvildflphsayynesilsehlsklrkmalqeeyamiepayrnggpvkpklalqcsgv 961  baker's yeast
730334        -------------------------------------------------------------------------------- Bacillus subtilis
20089903      -------------------------------------------------------------------------------- Methanosarcina ac...
15839412      -------------------------------------------------------------------------------- Mycobacterium tub...
15840441      -------------------------------------------------------------------------------- Mycobacterium tub...
15840800      -------------------------------------------------------------------------------- Mycobacterium tub...
17549638      -------------------------------------------------------------------------------- Ralstonia solanac...
15607177      -------------------------------------------------------------------------------- Mycobacterium tub...
15608153      -------------------------------------------------------------------------------- Mycobacterium tub...
1723051       -------------------------------------------------------------------------------- Mycobacterium tub...
6324667   962 dyrdesvdtrshtkltdfksiLEILEwrisnygnetafsdgTNTNLVNSSASndNnvhkkvswasfgkivagfLKKivgs 1041 baker's yeast
730334    378 ---------------------SPIPG---------------FSMRIVNDHNElvE------------------EGE---- 399  Bacillus subtilis
20089903  315 ---------------------KAIPG---------------VTLDVFDFECR--S------------------VEPn--- 335  Methanosarcina ac...
15839412  368 ----------------------------------------gYEVRIDA-------------------------------- 375  Mycobacterium tub...
15840441  350 -------------------rrLATLGpll----------qdLEARIID-EQ----------------------GDV---- 373  Mycobacterium tub...
15840800  293 ---------------------------------------pgMEVRISCGDQ----------------------AAG---- 307  Mycobacterium tub...
17549638  368 ---------------------YPVAG---------------LQIRVVDESG---A------------------PLPd--- 387  Ralstonia solanac...
15607177  368 ----------------------------------------gYEVRIDA-------------------------------- 375  Mycobacterium tub...
15608153  357 -------------------rrLATLGpll----------qdLEARIID-EQ----------------------GDV---- 380  Mycobacterium tub...
1723051   349 ---------------------------------------pgMEVRISCGDQ----------------------AAG---- 363  Mycobacterium tub...
6324667  1042 kiplkhgdpiiimceNSveyVAMimaclycnlLVIPlpsvKESVIEEDLKGlvniiqsykvkrvfvdaklhsllndnnvv 1121 baker's yeast
730334    400 --------------------IGR---------FQVS----GLSVTSGYYQR----------------------------- 417  Bacillus subtilis
20089903  336 -------------------iEGE---------LVAR----GENILIGYLDD----------------------------- 354  Methanosarcina ac...
15839412  376 ---------------APgarAGT---------IKLR----GDSVAAKAYVG----------------------------- 398  Mycobacterium tub...
15840441  374 ---------------MPargVGV---------IELR----GESLTPGYLTM----------------------------- 396  Mycobacterium tub...
15840800  308 ---------------NAsreIGE---------IEIR----GASMMAGYL------------------------------- 328  Mycobacterium tub...
17549638  388 ---------------GE---TGE---------LQLR----GPMVFGHYHKN----------------------------- 407  Ralstonia solanac...
15607177  376 ---------------APgarAGT---------IKLR----GDSVAAKAYVG----------------------------- 398  Mycobacterium tub...
15608153  381 ---------------MPargVGV---------IELR----GESLTPGYLTM----------------------------- 403  Mycobacterium tub...
1723051   364 ---------------NAsreIGE---------IEIR----GASMMAGYL------------------------------- 384  Mycobacterium tub...
6324667  1122 nkcfkkyksliPKITVFsKVKTknaltvsmfknvlkqkfgakpgtrigmtpcvvwvnteydvtsnihvtmthssllnask 1201 baker's yeast
730334    418 -----------PDLNES-VFTEd--------------------------------------------------------- 428  Bacillus subtilis
20089903  355 -----------EIATKSkVVN----------------------------------------------------------- 364  Methanosarcina ac...
15839412  399 -----------GKKLDAld------------------------------------------------------------- 406  Mycobacterium tub...
15840441  397 -----------GGFIPAqd------------------------------------------------------------- 404  Mycobacterium tub...
15840800  329 ------------GQQPid-------------------------------------------------------------- 334  Mycobacterium tub...
17549638  408 -----------EEATRQ-AFTEd--------------------------------------------------------- 418  Ralstonia solanac...
15607177  399 -----------GKKLDAld------------------------------------------------------------- 406  Mycobacterium tub...
15608153  404 -----------GGFIPAqd------------------------------------------------------------- 411  Mycobacterium tub...
1723051   385 ------------GQQPid-------------------------------------------------------------- 390  Mycobacterium tub...
6324667  1202 ivketlqlrnnsPLFsicshtsglgfmfscllgIYTGASTcLFSLTdvltdpkefliGLqnlnvkdlylkletlYALLDR 1281 baker's yeast
730334    429 -------------GW------------------FETGDLG--FLRN-----------GR---------------LTITGR 449  Bacillus subtilis
20089903  365 -------------GW------------------LHTGDLA-QKLPN-----------GY---------------IRLLGR 386  Methanosarcina ac...
15839412  407 -----------eEGF------------------CDTHDL--GFLVDd--------------------------eIVILGR 429  Mycobacterium tub...
15840441  405 -----------eHGW------------------YDTGDL--GYLTEeg-------------------------hVVVCGR 428  Mycobacterium tub...
15840800  335 -----------pDDW------------------FATGDL--GYLGAg--------------------------gLVVCGR 357  Mycobacterium tub...
17549638  419 -------------GW------------------FRSGDLG-QIHG------------GQ---------------LRLVGR 439  Ralstonia solanac...
15607177  407 -----------eEGF------------------CDTHDL--GFLVDd--------------------------eIVILGR 429  Mycobacterium tub...
15608153  412 -----------eHGW------------------YDTGDL--GYLTEeg-------------------------hVVVCGR 435  Mycobacterium tub...
1723051   391 -----------pDDW------------------FATGDL--GYLGAg--------------------------gLVVCGR 413  Mycobacterium tub...
6324667  1282 aSSliegfknkkENINSAKNNTSGSLREDVFKGVRnimipfpnrpriytienilkrystislsctqisyvyqhhfnpLIS 1361 baker's yeast
730334    450 -TK---------DAIIINGINYYSHAIESAVEELPe----------------------------------------iETS 479  Bacillus subtilis
20089903  387 -KD---------DIIKIGDHRVNPREIERYIEENN------------------------------------------TVS 414  Methanosarcina ac...
15839412  430 -QD---------EVFIVHGENRFPYDIEFIIRGESe------------------------------------------QH 457  Mycobacterium tub...
15840441  429 -VK---------DVIIMAGRNIYPTDIERAAGRVDg----------------------------------------vRPG 458  Mycobacterium tub...
15840800  358 -AK---------EVISIAGRNIFPTEVELVAAQVRg----------------------------------------vREG 387  Mycobacterium tub...
17549638  440 -SK---------DSIVVSGANYFSHELEVALEQLD------------------------------------------GIE 467  Ralstonia solanac...
15607177  430 -QD---------EVFIVHGENRFPYDIEFIIRGESe------------------------------------------QH 457  Mycobacterium tub...
15608153  436 -VK---------DVIIMAGRNIYPTDIERAAGRVDg----------------------------------------vRPG 465  Mycobacterium tub...
1723051   414 -AK---------EVISIAGRNIFPTEVELVAAQVRg----------------------------------------vREG 443  Mycobacterium tub...
6324667  1362 LRSYLDIPPVdlyldpfslregiirevnpndvsagnyikiqdsgvvpvctdvsvvnpetllpcVDGEFGEIWCCSEANAF 1441 baker's yeast
730334    480 YTAACAVRLGq----------------------------------------------------NSTDQLAIFFVTSAKLN 507  Bacillus subtilis
20089903  415 RVFVVPVSHE-----------------------------------------------------LMGTAISLMVMPAEGt- 440  Methanosarcina ac...
15839412  458 RTKVACFG--------------------------------------------------------VNERVVVVLES--PLD 479  Mycobacterium tub...
15840441  459 CAVAVRLDAg-----------------------------------------------------HSRESFAVAVESNAFED 485  Mycobacterium tub...
15840800  388 AVVALGTGDr-----------------------------------------------------STRPGLVVAAEFRG-PD 413  Mycobacterium tub...
17549638  468 RSFVAAFPTR-----------------------------------------------------PKGVDTELLVVIFATTI 494  Ralstonia solanac...
15607177  458 RTKVACFG--------------------------------------------------------VNERVVVVLES--PLD 479  Mycobacterium tub...
15608153  466 CAVAVRLDAg-----------------------------------------------------HSRESFAVAVESNAFED 492  Mycobacterium tub...
1723051   444 AVVALGTGDr-----------------------------------------------------STRPGLVVAAEFRG-PD 469  Mycobacterium tub...
6324667  1442 dyfvcnssknklykdpfitEQFkskmkSEVNNTLSYLRtgdlgfiknvsctnsqgevvnlnlLFVLGSIHESIEILglth 1521 baker's yeast
730334    508 --------------------DE-----QMSQLLRNIQSh----------------------vSQVIGVTPEYLLPVq--- 537  Bacillus subtilis
20089903  441 ---------------------------EIEALYAFCRK------------------------NFPGYLCPREILFI---- 465  Methanosarcina ac...
15839412  480 si----------------iDKA-----EADRLRCQVVA------------------------ATGLQLDELITVRR---- 510  Mycobacterium tub...
15840441  486 pa----------------eVRR-----IEHQVAHEVVA------------------------EVDVRPRNVVVLGP---- 516  Mycobacterium tub...
15840800  414 ea----------------nAR--------AELIQRVAS------------------------ECGIVPSDVVFVSP---- 441  Mycobacterium tub...
17549638  495 pl----------------nDEA-----RLHQLNVAIRNt----------------------tILLWGFRPALILPLp--- 528  Ralstonia solanac...
15607177  480 si----------------iDKA-----EADRLRCQVVA------------------------ATGLQLDELITVRR---- 510  Mycobacterium tub...
15608153  493 pa----------------eVRR-----IEHQVAHEVVA------------------------EVDVRPRNVVVLGP---- 523  Mycobacterium tub...
1723051   470 ea----------------nAR--------AELIQRVAS------------------------ECGIVPSDVVFVSP---- 497  Mycobacterium tub...
6324667  1522 fvsdlertvkdvhsdiGSCLIAKAGGLLVCLIRCKERHnpilgNLTTLIV 1571 baker's yeast
730334    538 ---------------kEEIPKTAIGKIQRTQLPIG--------------- 557  Bacillus subtilis
20089903  466 ----------------DYIPLSENGKISNRSIIEEYQH-----VKSSM-- 492  Methanosarcina acetivorans C2A
15839412  511 ----------------GAIPTTTSGKLKRRAVAQAYRDg---tLPRLATH 541  Mycobacterium tuberculosis CDC1551
15840441  517 ----------------GTIPKTPSGKLRRAN---SVTLvt---------- 537  Mycobacterium tuberculosis CDC1551
15840800  442 ----------------GSLPRTSSGKLRRLAVRRSLEMad---------- 465  Mycobacterium tuberculosis CDC1551
17549638  529 ---------------kTDFPKTSLGKIQRATLRKRLENgefseTIAYIEK 563  Ralstonia solanacearum
15607177  511 ----------------GAIPTTTSGKLKRRAVAQAYRDg---tLPRLATH 541  Mycobacterium tuberculosis H37Rv
15608153  524 ----------------GTIPKTPSGKLRRAN---SVTLvt---------- 544  Mycobacterium tuberculosis H37Rv
1723051   498 ----------------GSLPRTSSGKLRRLAVRRSLEMad---------- 521  Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap