Conserved Protein Domain Family
PitA

?
COG0306: PitA 
Phosphate/sulfate permease [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 223383
View PSSM: COG0306
Aligned: 71 rows
Threshold Bit Score: 127.315
Threshold Setting Gi: 16120177
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363     6 FDYIFAIAMLFAFLDAFNIGANDVANSFASSISSRSLKYWQAMVLAGLCEFLGAVLAGARVSGTIKNNIIDSSIFTndpA 85
gi 11498397   1 --MDVTIALVAALAIAFAIGSNDTCNSFGICVGCGLLTMKRAAYILFLLVFAGMLFGSGRIMDTVGREMVELN------- 71
gi 2496086    4 IEISINLELIISFYLLFILGANNVANAIGTAYASRATTYRNLLILFSISVIIG-SLFAKNVGSTVNSLSSD--------- 73
gi 20093999   2 NVLEVLVVVVPSLYMGWTIGADDAGAAMGSAVGAGVRTMRQAVTLIAVFTTMGAVLEGHKVVKTLGKGVVQAH------- 74
gi 15679873   1 MDTLIAISLILSLYMAFNIAANDIGNSVGTAVGSGSLKMRRALILGAFFVSLGAILLGGNVIKTISEGIIPQGFFS---- 76
gi 14521288   1 -MSLTLALLSIVFYIAWNIGANGTANAMGVVVGSGILSFRQAVLTIAIFTILGAYLRGEKVMETVGRGIVP--------V 71
gi 14590960   1 -MDISLVLLSIAFYIAWNIGANGSANAMGVVVGSGILSFRQAVLTIAVFTLLGAYLRGEKVMETVGRKVIY--------S 71
gi 15899205  10 QNIIEYLLFIVGLISSYVIGANNNATSLGILFATNAIKRRYAYILNMVSILVGVVLGSLTMLHSVYGVVYG-NS-----L 83
gi 13540894   1 ----MQYLLLLSFLLVILVAGNNTSAVSGTLIGSRMVGRYYGLLMTAVGYVAGYLIEG-QFLKKAVSVLLP--------- 66
gi 16081200   1 ----MLAILIFSFLLVILVAGNNSSAVSGTIIGSKMMNKSLALAITAVGYIAGYLLEG-RFLQHAVNELLP--------- 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363    86 VLMLTMTSALIGSSCWLTFATAIGMPVSTTHSIVGGTIGAGIAAGGAngvVWGWSGVSQIIASWFIAP-ILAGAIAAIVF 164
gi 11498397  72 --EIVVSVSLIISSAAIVAANYLRTPVSSHQAIVMSLIGSAFALGNR----IDVSTVAKIVLSWVISP-FGALLLSIVFY 144
gi 2496086   74 -----ALTALIISALVMTLSTYKKVPISLHTVIICSLIGLNFNSSN------LY-VFGEILLSWILSP-IIAVVIAYILY 140
gi 20093999  75 LDPIAAGATVLVAAAWYHLAVMLGVPVSTTQATVGSIAGVGCALGLP----VNWSKFGQIAVGWFLSP-ILAMIPAYFVS 149
gi 15679873  77 --PRMALVITATASIWITFTIIKKIPISGSDAIVSSVIGAGVAAVGIq--nMRLDVIGFIVLSWIISPpLAGLLMGFLIY 152
gi 14521288  72 MTPEMVAIIFISAGIWVTIATLRGLPVSVTQTIIGNVVGVALALGLQ----VKWDVFGKIVLTWVISP-ILAGGIAFLLF 146
gi 14590960  72 MTPEMAIVILLSAGLCATIATLRGLPISVTQTIVGGVVGVGLALGVS----IQWKIFEKVIIAWILSP-ILSGIFAFMLY 146
gi 15899205  84 YVAIGIFTSLSSSIITFYYLNKSGIPSSLSQTFYPSIAILTLISHGf--iELDWVKFWVIVSSWVISP-IVAIGFSLLLY 160
gi 13540894  67 FPPEVVIYAILASFIIFVVAFFVKVPLSLTMALVGSSIGLSLKYGVN----LPKSFLLSIFVAWILAP-IISVVLSYYLN 141
gi 16081200  67 FEPEYVLYAIIASFVIFTIAFFVKVPISLTMALVGSAIGLSLKLGYS----SDARFLTEVIIAWIAAP-LISVGSSYVFN 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363   165 SISRFSVLEvkslersiknalllvgvlvfatfsiltmlivwkgspnlhlddlsetetavsivltgaiasivyfiffypfy 244
gi 11498397 145 WIMERTLAK----------------------------------------------------------------------- 153
gi 2496086  141 SAYEKIDIS----------------------------------------------------------------------- 149
gi 20093999 150 RRLRAVLEKg---------------------------------------------------------------------- 159
gi 15679873 153 HAIRNMIIKal--------------------------------------------------------------------- 163
gi 14521288 147 IVYSRtf------------------------------------------------------------------------- 153
gi 14590960 147 YFYYKaf------------------------------------------------------------------------- 153
gi 15899205 161 LTLNKVVSA----------------------------------------------------------------------- 169
gi 13540894 142 VVMSGKNYG----------------------------------------------------------------------- 150
gi 16081200 142 DRLSKMRHG----------------------------------------------------------------------- 150
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363   245 rrkvldqdwtlklidifrgpsfyfkstddippmpeghqltidyyegrrnlgttvsvedeenkaasnsndsvknkediqev 324
gi 11498397     --------------------------------------------------------------------------------
gi 2496086      --------------------------------------------------------------------------------
gi 20093999     --------------------------------------------------------------------------------
gi 15679873     --------------------------------------------------------------------------------
gi 14521288     --------------------------------------------------------------------------------
gi 14590960     --------------------------------------------------------------------------------
gi 15899205     --------------------------------------------------------------------------------
gi 13540894     --------------------------------------------------------------------------------
gi 16081200     --------------------------------------------------------------------------------
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363   325 dlvrtetepetklstkqywwsllkqgpkkwpllfwlvishgwtqdvihaqvndrdmlsgdlkgmyersKFYDNRVEYIYS 404
gi 11498397 154 ---------------------------------------------------------------------LPALRVERVLR 164
gi 2496086  150 ----------------------------------------------------------------------ILKKIT-MIR 158
gi 20093999 160 --------------------------------------------------------------------KWPLAEIERKIG 171
gi 15679873 164 ------------------------------------------------------------------qgMGLRDRAEKIFS 177
gi 14521288 154 ------------------------------------------------------------------rrIKSLRKLEILYK 167
gi 14590960 154 ------------------------------------------------------------------krIKSVKELEILYK 167
gi 15899205 170 --------------------------------------------------------------------ETRIIKQITIYK 181
gi 13540894 151 ----------------------------------------------------------------------NIWKYASAVK 160
gi 16081200 151 ----------------------------------------------------------------------DIWRYASAIK 160
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363   405 VLQAITAATMSFAHGANDVANATGPLSAVYViwktntigakSEVPVWVLAYGGVALVIGCWTYGYNIIKNLGNKMILQSP 484
gi 11498397 165 VLLFIGATVIGFNTGANELATALAPIVMFG-----------VMNVFEAALLGSAMLFLGAWIVSVRVAEVVGKGITALDP 233
gi 2496086  159 YFLLISAAVVAFNLGSNDLPTVLGTFTTS----------------QIIYIIGAIFLCLGAYLYGNRVSETLSMITN-LSV 221
gi 20093999 172 WLLTISGCYVAYTIGANNAANAVAPIVMTG-----------LLDVRSAAIVGGIMIAVGALTAGSKVIETVGRKITRLDP 240
gi 15679873 178 YLQIASSSFSALNLGAIDIAVATGVIFAVG-----------SFGGNWIRILGAIGLVAGILLAGNRVTETIGRRITDLTP 246
gi 14521288 168 WVAIMGSSYMAFNFGTNEVANTVGPLVGAGI-----------MGPREAGIFGAIGVAIGTLTFSYAVMYTVGKKITALGP 236
gi 14590960 168 GMAIAGGSYMAFNFGANEVANAVSPLIGAGI-----------LTYKGAGIFGALSLAIGSLTFSYPVMYTVGKKITALGP 236
gi 15899205 182 NLILFSSAFTSFIVGANAIGIIVSSALLS-------------APAYLVIPLYGISAALGVLT-SQRIAIRVGFRITKLGY 247
gi 13540894 161 LLLIFTALFTAFTLGANTIG-FIGNVIG---------------FNTENNIVIVAAVFLGTFMFSSGVMKSVSQNMYMLKY 224
gi 16081200 161 VMPIVTAIFTAFTLGANTIG-FLGDISG---------------TAVFNEILISIGSVIGTFFFSSGIMKSVSQNMYMMKY 224
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586363   485 SRGFSIELAVAITTVMATQLGIPTSTTQIAVGGIVAVGLCNKDLkSVNWRMVAWCYSGWFLTLPIAGLIAGIINGIILNA 564
gi 11498397 234 FTGFAAQFAAGITVLLFTLIGMPVSTTYCTVGAVTGVGLYKSVR-GVKFAFLKRIVASWILTPFTAFTLSFILTLLLSQQ 312
gi 2496086  222 SSAFIAQLSGGLAVTIFTALGMPVSTTQAIVGGILGVGLTKGIK-TVRWKVLKNIIFWWVVAPIIALIIGFIINRMI--- 297
gi 20093999 241 VTAFSAELSAAIVTHGASELGIPISINETTAGAVIGVG--LSRG-ELNTHTLKKIFTTWIASPVGSFVMSYALMRLYLSV 317
gi 15679873 247 SRGFSAQLAAAIIVYLFMGYGMPVSPTQTLVGSVIGVGIAHGTS-TVKYDVIGHIAYTWIVTIPTCIILSSAIYIITGFW 325
gi 14521288 237 VSAFSAQFGSAISVSLANYFGIPVSSGQAIVGGVVGAG--LAAGeeVRRDVISKVVLGWIVTPLTGIILSYGTTKLFLTV 314
gi 14590960 237 ISAFSAQFGSAISVSLANYFGLPVSSGQAIIGGIIGAS--IAGGgkIKQEIIERIISGWILAPVIGITLSYAVAKLFVFF 314
gi 15899205 248 LGASSALIGSNVINEIFTILGIPLSITQTIIGGIVGLSFRSFTS--DVRKQVIQIFRSWATSPIFAIILSLAIFGVIKSI 325
gi 13540894 225 TNAFTSQIVSALAVEVSTLFSIPMSNTQTLTSSVLGAGLSYKAK-AIYLRPFLYIVVMWIISPILGLVLTYVL------- 296
gi 16081200 225 TNAFSSQLISALVVEVSTLFSIPMSNTQTLTSAVLGAGLSYRAK-AIYLKPFLYIVIMWILSPLIGMAFTYALA------ 297

                .
gi 586363   565 P 565
gi 11498397 313 A 313
gi 2496086      -
gi 20093999 318 R 318
gi 15679873 326 G 326
gi 14521288 315 G 315
gi 14590960 315 N 315
gi 15899205 326 L 326
gi 13540894     -
gi 16081200     -
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap