Conserved Protein Domain Family
PitA

?
COG0306: PitA 
Phosphate/sulfate permease [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 223383
View PSSM: COG0306
Aligned: 71 rows
Threshold Bit Score: 127.315
Threshold Setting Gi: 16120177
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
586363     6 FDYIFAIAMLFAFLDAFNIGANDVANSFASSISSRSLKYWQAMVLAGLCEFLGAVLAGARVSGTIKNNIIDSSIFTndpA 85  baker's yeast
11498397   1 --MDVTIALVAALAIAFAIGSNDTCNSFGICVGCGLLTMKRAAYILFLLVFAGMLFGSGRIMDTVGREMVELN------- 71  Archaeoglobus fulgidus
2496086    4 IEISINLELIISFYLLFILGANNVANAIGTAYASRATTYRNLLILFSISVIIG-SLFAKNVGSTVNSLSSD--------- 73  Methanocaldococcus ...
20093999   2 NVLEVLVVVVPSLYMGWTIGADDAGAAMGSAVGAGVRTMRQAVTLIAVFTTMGAVLEGHKVVKTLGKGVVQAH------- 74  Methanopyrus kandle...
15679873   1 MDTLIAISLILSLYMAFNIAANDIGNSVGTAVGSGSLKMRRALILGAFFVSLGAILLGGNVIKTISEGIIPQGFFS---- 76  Methanothermobacter...
14521288   1 -MSLTLALLSIVFYIAWNIGANGTANAMGVVVGSGILSFRQAVLTIAIFTILGAYLRGEKVMETVGRGIVP--------V 71  Pyrococcus abyssi
14590960   1 -MDISLVLLSIAFYIAWNIGANGSANAMGVVVGSGILSFRQAVLTIAVFTLLGAYLRGEKVMETVGRKVIY--------S 71  Pyrococcus horikoshii
15899205  10 QNIIEYLLFIVGLISSYVIGANNNATSLGILFATNAIKRRYAYILNMVSILVGVVLGSLTMLHSVYGVVYG-NS-----L 83  Sulfolobus solfatar...
13540894   1 ----MQYLLLLSFLLVILVAGNNTSAVSGTLIGSRMVGRYYGLLMTAVGYVAGYLIEG-QFLKKAVSVLLP--------- 66  Thermoplasma volcanium
16081200   1 ----MLAILIFSFLLVILVAGNNSSAVSGTIIGSKMMNKSLALAITAVGYIAGYLLEG-RFLQHAVNELLP--------- 66  Thermoplasma acidop...
586363    86 VLMLTMTSALIGSSCWLTFATAIGMPVSTTHSIVGGTIGAGIAAGGAngvVWGWSGVSQIIASWFIAP-ILAGAIAAIVF 164 baker's yeast
11498397  72 --EIVVSVSLIISSAAIVAANYLRTPVSSHQAIVMSLIGSAFALGNR----IDVSTVAKIVLSWVISP-FGALLLSIVFY 144 Archaeoglobus fulgidus
2496086   74 -----ALTALIISALVMTLSTYKKVPISLHTVIICSLIGLNFNSSN------LY-VFGEILLSWILSP-IIAVVIAYILY 140 Methanocaldococcus ...
20093999  75 LDPIAAGATVLVAAAWYHLAVMLGVPVSTTQATVGSIAGVGCALGLP----VNWSKFGQIAVGWFLSP-ILAMIPAYFVS 149 Methanopyrus kandle...
15679873  77 --PRMALVITATASIWITFTIIKKIPISGSDAIVSSVIGAGVAAVGIq--nMRLDVIGFIVLSWIISPpLAGLLMGFLIY 152 Methanothermobacter...
14521288  72 MTPEMVAIIFISAGIWVTIATLRGLPVSVTQTIIGNVVGVALALGLQ----VKWDVFGKIVLTWVISP-ILAGGIAFLLF 146 Pyrococcus abyssi
14590960  72 MTPEMAIVILLSAGLCATIATLRGLPISVTQTIVGGVVGVGLALGVS----IQWKIFEKVIIAWILSP-ILSGIFAFMLY 146 Pyrococcus horikoshii
15899205  84 YVAIGIFTSLSSSIITFYYLNKSGIPSSLSQTFYPSIAILTLISHGf--iELDWVKFWVIVSSWVISP-IVAIGFSLLLY 160 Sulfolobus solfatar...
13540894  67 FPPEVVIYAILASFIIFVVAFFVKVPLSLTMALVGSSIGLSLKYGVN----LPKSFLLSIFVAWILAP-IISVVLSYYLN 141 Thermoplasma volcanium
16081200  67 FEPEYVLYAIIASFVIFTIAFFVKVPISLTMALVGSAIGLSLKLGYS----SDARFLTEVIIAWIAAP-LISVGSSYVFN 141 Thermoplasma acidop...
586363   165 SISRFSVLEvkslersiknalllvgvlvfatfsiltmlivwkgspnlhlddlsetetavsivltgaiasivyfiffypfy 244 baker's yeast
11498397 145 WIMERTLAK----------------------------------------------------------------------- 153 Archaeoglobus fulgidus
2496086  141 SAYEKIDIS----------------------------------------------------------------------- 149 Methanocaldococcus ...
20093999 150 RRLRAVLEKg---------------------------------------------------------------------- 159 Methanopyrus kandle...
15679873 153 HAIRNMIIKal--------------------------------------------------------------------- 163 Methanothermobacter...
14521288 147 IVYSRtf------------------------------------------------------------------------- 153 Pyrococcus abyssi
14590960 147 YFYYKaf------------------------------------------------------------------------- 153 Pyrococcus horikoshii
15899205 161 LTLNKVVSA----------------------------------------------------------------------- 169 Sulfolobus solfatar...
13540894 142 VVMSGKNYG----------------------------------------------------------------------- 150 Thermoplasma volcanium
16081200 142 DRLSKMRHG----------------------------------------------------------------------- 150 Thermoplasma acidop...
586363   245 rrkvldqdwtlklidifrgpsfyfkstddippmpeghqltidyyegrrnlgttvsvedeenkaasnsndsvknkediqev 324 baker's yeast
11498397     -------------------------------------------------------------------------------- Archaeoglobus fulgidus
2496086      -------------------------------------------------------------------------------- Methanocaldococcus ...
20093999     -------------------------------------------------------------------------------- Methanopyrus kandle...
15679873     -------------------------------------------------------------------------------- Methanothermobacter...
14521288     -------------------------------------------------------------------------------- Pyrococcus abyssi
14590960     -------------------------------------------------------------------------------- Pyrococcus horikoshii
15899205     -------------------------------------------------------------------------------- Sulfolobus solfatar...
13540894     -------------------------------------------------------------------------------- Thermoplasma volcanium
16081200     -------------------------------------------------------------------------------- Thermoplasma acidop...
586363   325 dlvrtetepetklstkqywwsllkqgpkkwpllfwlvishgwtqdvihaqvndrdmlsgdlkgmyersKFYDNRVEYIYS 404 baker's yeast
11498397 154 ---------------------------------------------------------------------LPALRVERVLR 164 Archaeoglobus fulgidus
2496086  150 ----------------------------------------------------------------------ILKKIT-MIR 158 Methanocaldococcus ...
20093999 160 --------------------------------------------------------------------KWPLAEIERKIG 171 Methanopyrus kandle...
15679873 164 ------------------------------------------------------------------qgMGLRDRAEKIFS 177 Methanothermobacter...
14521288 154 ------------------------------------------------------------------rrIKSLRKLEILYK 167 Pyrococcus abyssi
14590960 154 ------------------------------------------------------------------krIKSVKELEILYK 167 Pyrococcus horikoshii
15899205 170 --------------------------------------------------------------------ETRIIKQITIYK 181 Sulfolobus solfatar...
13540894 151 ----------------------------------------------------------------------NIWKYASAVK 160 Thermoplasma volcanium
16081200 151 ----------------------------------------------------------------------DIWRYASAIK 160 Thermoplasma acidop...
586363   405 VLQAITAATMSFAHGANDVANATGPLSAVYViwktntigakSEVPVWVLAYGGVALVIGCWTYGYNIIKNLGNKMILQSP 484 baker's yeast
11498397 165 VLLFIGATVIGFNTGANELATALAPIVMFG-----------VMNVFEAALLGSAMLFLGAWIVSVRVAEVVGKGITALDP 233 Archaeoglobus fulgidus
2496086  159 YFLLISAAVVAFNLGSNDLPTVLGTFTTS----------------QIIYIIGAIFLCLGAYLYGNRVSETLSMITN-LSV 221 Methanocaldococcus ...
20093999 172 WLLTISGCYVAYTIGANNAANAVAPIVMTG-----------LLDVRSAAIVGGIMIAVGALTAGSKVIETVGRKITRLDP 240 Methanopyrus kandle...
15679873 178 YLQIASSSFSALNLGAIDIAVATGVIFAVG-----------SFGGNWIRILGAIGLVAGILLAGNRVTETIGRRITDLTP 246 Methanothermobacter...
14521288 168 WVAIMGSSYMAFNFGTNEVANTVGPLVGAGI-----------MGPREAGIFGAIGVAIGTLTFSYAVMYTVGKKITALGP 236 Pyrococcus abyssi
14590960 168 GMAIAGGSYMAFNFGANEVANAVSPLIGAGI-----------LTYKGAGIFGALSLAIGSLTFSYPVMYTVGKKITALGP 236 Pyrococcus horikoshii
15899205 182 NLILFSSAFTSFIVGANAIGIIVSSALLS-------------APAYLVIPLYGISAALGVLT-SQRIAIRVGFRITKLGY 247 Sulfolobus solfatar...
13540894 161 LLLIFTALFTAFTLGANTIG-FIGNVIG---------------FNTENNIVIVAAVFLGTFMFSSGVMKSVSQNMYMLKY 224 Thermoplasma volcanium
16081200 161 VMPIVTAIFTAFTLGANTIG-FLGDISG---------------TAVFNEILISIGSVIGTFFFSSGIMKSVSQNMYMMKY 224 Thermoplasma acidop...
586363   485 SRGFSIELAVAITTVMATQLGIPTSTTQIAVGGIVAVGLCNKDLkSVNWRMVAWCYSGWFLTLPIAGLIAGIINGIILNA 564 baker's yeast
11498397 234 FTGFAAQFAAGITVLLFTLIGMPVSTTYCTVGAVTGVGLYKSVR-GVKFAFLKRIVASWILTPFTAFTLSFILTLLLSQQ 312 Archaeoglobus fulgidus
2496086  222 SSAFIAQLSGGLAVTIFTALGMPVSTTQAIVGGILGVGLTKGIK-TVRWKVLKNIIFWWVVAPIIALIIGFIINRMI--- 297 Methanocaldococcus ...
20093999 241 VTAFSAELSAAIVTHGASELGIPISINETTAGAVIGVG--LSRG-ELNTHTLKKIFTTWIASPVGSFVMSYALMRLYLSV 317 Methanopyrus kandle...
15679873 247 SRGFSAQLAAAIIVYLFMGYGMPVSPTQTLVGSVIGVGIAHGTS-TVKYDVIGHIAYTWIVTIPTCIILSSAIYIITGFW 325 Methanothermobacter...
14521288 237 VSAFSAQFGSAISVSLANYFGIPVSSGQAIVGGVVGAG--LAAGeeVRRDVISKVVLGWIVTPLTGIILSYGTTKLFLTV 314 Pyrococcus abyssi
14590960 237 ISAFSAQFGSAISVSLANYFGLPVSSGQAIIGGIIGAS--IAGGgkIKQEIIERIISGWILAPVIGITLSYAVAKLFVFF 314 Pyrococcus horikoshii
15899205 248 LGASSALIGSNVINEIFTILGIPLSITQTIIGGIVGLSFRSFTS--DVRKQVIQIFRSWATSPIFAIILSLAIFGVIKSI 325 Sulfolobus solfatar...
13540894 225 TNAFTSQIVSALAVEVSTLFSIPMSNTQTLTSSVLGAGLSYKAK-AIYLRPFLYIVVMWIISPILGLVLTYVL------- 296 Thermoplasma volcanium
16081200 225 TNAFSSQLISALVVEVSTLFSIPMSNTQTLTSAVLGAGLSYRAK-AIYLKPFLYIVIMWILSPLIGMAFTYALA------ 297 Thermoplasma acidop...
586363   565 P 565 baker's yeast
11498397 313 A 313 Archaeoglobus fulgidus
2496086      - Methanocaldococcus jannaschii
20093999 318 R 318 Methanopyrus kandleri AV19
15679873 326 G 326 Methanothermobacter thermautotrophicus str. Delta H
14521288 315 G 315 Pyrococcus abyssi
14590960 315 N 315 Pyrococcus horikoshii
15899205 326 L 326 Sulfolobus solfataricus
13540894     - Thermoplasma volcanium
16081200     - Thermoplasma acidophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap