Conserved Protein Domain Family
DltE

?
COG0300: DltE 
Short-chain dehydrogenase [General function prediction only]
Statistics
?
PSSM-Id: 223377
View PSSM: COG0300
Aligned: 40 rows
Threshold Bit Score: 228.286
Threshold Setting Gi: 15004755
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
586299    57 YGAKTGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELC 136 baker's yeast
1731078    1 MKHIAGKRIWITGASGGLGERIAYLCAAEGAHVLLSARREDRLIEIKRKITEEWSGQCEIFPLDVGRLEDIAR----VRD 76  Bacillus subtilis
15004755   1 -----MKKAIVIGATSGIGMETAKKLAENGYIVGITGRRKERLINLQKSIKTKT----FIKQIDICKPNMAIELLKELID 71  Clostridium acetobu...
15672613   1 ----MVRNIVITGATGDIAKEIVKSLSKENDHLILVSRSRKALIERYGQLENVT-----LLTND-------ELLTNE--- 61  Lactococcus lactis ...
20090936   1 -MKIDGKNIVITGASKGLGRELALHLSRKNANVILIARTESLLRKVQTEIETLTAHAPCIIQCDISSEKEVLRMRSIIEN 79  Methanosarcina acet...
15927083   1 ---MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKT---INVIPCDLNDLKSIQALQFEDNT 74  Staphylococcus aure...
15900576   1 -----MPTILITGASGGLAQEMVKLLPN--DQLILLGRNKEKLAQLYGNYSHAE-----LIEIDITDDSALEALVTDLYL 68  Streptococcus pneum...
15674945   1 ---MAQRIIVITGASGGLAQAIVKQLPKE-DSLILLGRNKERLEHCYQHIDNKE-----CLELDITNPVAIEKMVAQIYQ 71  Streptococcus pyoge...
15897898   1 ----MSEVAIVTGASKGIGRAVVKLLKENNYTVVSISRSKS-------DIGD-----V-IYDADVSDRSTVFRIVNEVLE 63  Sulfolobus solfatar...
16801149   2 NPFLKNKTVLITGASNGLGAEIARQVAASGGNVIITARSTEKLLDLQKDIHDNFSVEATYFTLDMTDFEQVKQVS-AEIN 80  Listeria innocua
586299   137 AQLPITVLVNNVGQSHSIpvPFLETEEKELRNIITINNTATLLITQIIAPKIVEtvkaenkksGTRGLILTMGSFGGLIP 216 baker's yeast
1731078   77 QIGSIDVLINNAGFGIFE--TVLDSTLDDMKAMFDVNVFGLIACTKAVLPQMLE---------QKKGHIINIASQAGKIA 145 Bacillus subtilis
15004755  72 ELGGLDLIVISSGIVRPN----LELSWSNEEETIATNISGFAAMANTASQYFMK---------QKYGHIVGISSMSSLVY 138 Clostridium acetobu...
15672613  62 QSFVVDILINNAGFGIFK--EFTELTDGEITEQFVINTLMPIQLTRLLEPKV-------------Q--LINIASIAGKLP 124 Lactococcus lactis ...
20090936  80 NFTCVDVLINNAGFGTYE--VSEKLSNQEMRKHFEVNFFGAYYCTKALLPLIKK---------SDCGYILNVGSLFSKIS 148 Methanosarcina acet...
15927083  75 S---FDGFIYSAGLGYFK--SISDHSFSEMIETYQLNLISFNVLYTVLRPYLTS---------N--AHIVGISSQAAFST 138 Staphylococcus aure...
15900576  69 RYGKIDVLINNAGYGIFE--GFDQIADKDIHQMFEVNTFALMNLSRHLAARMKE---------SSKGHIINIVSMAGLIA 137 Streptococcus pneum...
15674945  72 RYGRIDVLINNAGYGAFK--GFEEFSAQEIADMFQVNTLASIHFACLIGQKMAE---------QGQGHLINIVSMAGLIA 140 Streptococcus pyoge...
15897898  64 KFGKIDVLVNNAGFGVYG--SFLETDLNEEEYMIRTNLLAPLYFMKAVLPHMVS---------RRKGSVVNIVSEAAYVS 132 Sulfolobus solfatar...
16801149  81 ASYQIDVLVNCAGFGLFE--NAVDIPFETIEKMFDTNVLGLIQLTQLILPQMQA---------RKAGHIINIASQAAKIA 149 Listeria innocua
586299   217 TPLLATYSGSKSFLQGWSNSLAGEL--SKDAIDVELIISYLVTSSMSKiRrsslmipnpqQFVKSTLRSVGRRCGSQERY 294 baker's yeast
1731078  146 TPKSSLYSATKHAVLGYSNALRMEL--SGTGIYVTTVNPGPIQTDFFSiA----------DKGGDYAKNVGRWMLDPDDV 213 Bacillus subtilis
15004755 139 SDRSNAYCASKAFVSNYLRGLRILLtkASKRIYVTEVVPGWVYTEMT-------------KQADKSK---LFWTTTADKA 202 Clostridium acetobu...
15672613 125 TGKSSIYVASKAALITFSDALRMEN--PQ--LIVTTVNTGPVKTKFHK------------D-NGDYLEKVGKNAISASKV 187 Lactococcus lactis ...
20090936 149 LAENSVYAATKFALAGFTEGLREEL--RPCNIKVGLLLPGSMATSFQ-------------DNKDNNIRAPAFMTLKPEKV 213 Methanosarcina acet...
15927083 139 QANAAHYGASKAGFYALMNALRLES--PN--LHIMTVNVGPIDTPFHQkA----------DPSMKYAKKMGEIMLDANQL 204 Staphylococcus aure...
15900576 138 TGKSSLYSATKFAAIGFSNALRLEL--MPYGVYVTTVNPGPIRTGFFDqA----------DPDGTYLKSVDRFLLEPDAV 205 Streptococcus pneum...
15674945 141 SAKSSIYSATKFALIGFSNALRLEL--ADKGVYVTTVNPGPIATKFFDqA----------DPSGHYLESVGKFTLQPNQV 208 Streptococcus pyoge...
15897898 133 TPKLLVYSATKAGLASLTNGLWAEM--RKYNVRVSGVYPGPVRTNFTShP----------SFKKNNGDPFANYSVEPEAV 200 Sulfolobus solfatar...
16801149 150 TPKSTVYSATKYAVLGFSNALRLEL--MPDKIHVTTINPGPIATNFFDvA----------DKSGNYLETVGKLVLQPEKV 217 Listeria innocua
586299   295 ATMTPYWAHAVYQFVITEtfgvYSKIVNSINYSFHKSIRIRALKKAARQVKK 346 baker's yeast
1731078  214 AAQITAAIFTKKREINLP----RLMNAGTKLYQLFPALVEKLAGRALMKK-- 259 Bacillus subtilis
15004755 203 AEEIYTSILKKKRKIYISk---RWRLLAWLINILPESFRVK----------- 240 Clostridium acetobutylicum
15672613 188 ADKVVNNLGKRKREINLP----WTLSTAAKLRAIFPSLFDFISAKFFNFK-- 233 Lactococcus lactis subsp. lactis
20090936 214 AKASEKMIRKRKKQMIIY--------RWMMYLIKIRQLFA------------ 245 Methanosarcina acetivorans C2A
15927083 205 AEDIIYGIKTKQLEINRP----KWMHHALKMYQIAPRFFERCFPKLFKNKA- 251 Staphylococcus aureus subsp. aureus N315
15900576 206 AKKIVKIIGKNKRELNLP----ILLNLAHKFYTLFPKLADKLAGETFNYK-- 251 Streptococcus pneumoniae TIGR4
15674945 209 AKRLVSIIGKNKRELNLP----FSLAVTHQFYTLFPKLSDYLARKVFNYK-- 254 Streptococcus pyogenes M1 GAS
15897898 201 AKAVLKAIRTGKREIYVP-----SRLKLDPYFLKLANLFQSFTYTIVSNYFS 247 Sulfolobus solfataricus
16801149 218 ARKTVQIMGTKRREINLP----FVMNIATRLYQVMPQVIEFFGKGAFLKK-- 263 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap