Conserved Protein Domain Family
RlmE

?
COG0293: RlmE 
23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 223370
View PSSM: COG0293
Aligned: 41 rows
Threshold Bit Score: 131.577
Threshold Setting Gi: 15669443
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226708    1 MGKTqkKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYgHFLEK--SKVVIDLCAAPGSWCQVASKLCPVNSl----- 73
gi 9910941    1 --------MYRLDDEYSKKAKREGYLARSVYKLIEINEKF-SLFSS---GNVLDIGASPGSFSQYAYKKLKRGi------ 62
gi 19173214   1 ------MDGEEKRDVYYRLAKKNKYRARSVYKLMHIDEEH-DIFRD--VEGVVDLCAAPGSWSQYASEKLLKRNrg---- 67
gi 15669443 161 defnelvieeniknlknlkryierplNRSERKMQELMEKFpFIFEN--INCVVDIGSSPGGWAKMLSKKAKK-------- 230
gi 20093782 157 svvppdlivskevkrvrkwspgmrpiSRAQLKLRELLKRHpYIVRE--GSDVIDLGAAPGGWSYELARRVEPG------- 227
gi 9910977    1 MGRS----SKDKRDAYYRLAKEQGWRARSAFKLLQLNEQF-NLFEG--AKRVVDLCAAPGSWSQVLSRELLKNIdtsiaa 73
gi 9910943    1 ------MNVYKRADFWAKKAAAAGYRARSVYKLAALDKKY-SLLSR--ASRVLDLGAAPGSWTQYVLGTAAACTa----- 66
gi 13541120   1 -------MTGDRRDEYYWKAKKEQLRSRAAFKLEFLLDRY-RVVRK--GDAVIEIGSSPGGWTQVLNSLARK-------- 62
gi 16082347   1 -------MSSDHRDQYYWRAKRDQFRSRAAYKLEFLIERY-GIIKD--GQAVLEIGSSPGGWTQVLVDHGCR-------- 62
gi 586500     1 MGKS----SKDKRDLYYRKAKEQGYRARSAFKLLQLNDQF-HFLDDpnLKRVVDLCAAPGSWSQVLSRKLFDESpssdk- 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6226708   74 -----IIGVDIVPMKPMPN---VITFQSDITTEDCRSKLRGYMKTWK---ADTVLHDGAP----NVGLGWVQDAFTQSQL 138
gi 9910941   63 -----LVSVDINDIGLRYDd-nFYFIKGDIFLDDTVFKINTFKPY------SLVISDVAP----KTTGNRLVDTSNSFNL 126
gi 19173214  68 ---arIVSVDIQDIVPIEG---VMCIKDDITSASCLEKILEVLGRPA----DLVICDGAP----DITGIHEIDEYLQIEL 133
gi 15669443 231 -----VYAIDTGELKIKANn--IIHIKKRAENVDFEKDINEEIDLIT----NDTN--LYP------------DESLFLTL 285
gi 20093782 228 ------TVYAVDPGDLHPK---VLKLDNVVHLKKRAEELTEDDIEGR---IRLVTSDLNRihteATEVTLSVADEFLEPG 295
gi 9910977   74 dekpmIVAVDLQPMAPIDG---VCTLQLDITHPNTLSIILSHFGNEP---ADLVVSDGAP----DVTGLHDLDEYIQAQI 143
gi 9910943   67 -----VCAVDVQPIASDIQdarLQRVQGDLCAADTRARVACNAPF------DLILSDAAP----RTTGNRTVDTSASACL 131
gi 13541120  63 -----IISIDLQEMEEIAG---VRFIRCDIFKETIFDDIDRALREEGiekVDDVVSDAMA----KVSGIPSRDHAVSYQI 130
gi 16082347  63 -----VVAVDIQPMDEIPG---VIFLKLNILREDAAERIREEMARSLvqrFDVVLSDAMA----KTSGIRSSDHAASVMI 130
gi 586500    75 -edrkIVSVDLQPMSPIPH---VTTLQADITHPKTLARILKLFGNEK---ADFVCSDGAP----DVTGLHDLDEYVQQQL 143
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 6226708  139 TLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKVEATKPPASRNVSA-EIFVVCKGFKAPK 206
gi 9910941  127 SMRIIDLSLEVLLKKGNLLVKVFQGGDEMQIFKKFEKYFKFVKKIRPKAVRKNSF-EIYFLGKSFGK-- 192
gi 19173214 134 LKSALATSLRVSRPGSSFVGKYLRGECTPYIAGHFRKFYGGVTLLKPKASRTDSM-ECFLYCTGMKDTG 201
gi 15669443 286 KFAKHLKTNGYIIHTLKARNLKTKKEDLEKVLKILS-YYRNIKIFKIINLRANTKnELTLILKKV---- 349
gi 20093782 296 GFIVQTVKLAVDPSTGEYAAPDVETAVSEVELEYERRGYEILAIERLKRNTPNER-TLVARKV------ 357
gi 9910977  144 LLAAFNLAVCVLKPGGKFVAKIFRGRDVSLLYSQLRLMFRKVSCAKPRSSRASSI-ESFVVCEDFNPPS 211
gi 9910943  132 AAGVCAYVN-FLSSDGGLVFKVFQGSEHLAILTHLRAHFGAVCSFKPPASRPRSC-ELYVVARFFRGTC 198
gi 13541120 131 GQRVMEIAVRYLRNGGNVLLKQFQGDMTNDFIAIWRKNFSSYKISKPPASRGSSS-EIYIMFFGFKAP- 197
gi 16082347 131 GNAVMKIAMDTLRRGGVAVVKQFQGDMTGDFIKNWGHYFRDHRITKPPASRKESS-EVYIIFYGFSGKE 198
gi 586500   144 IMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSL-EAFIVCLGYNPPS 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap