Conserved Protein Domain Family
GyrA

?
COG0188: GyrA 
DNA gyrase/topoisomerase IV, subunit A [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223266
View PSSM: COG0188
Aligned: 96 rows
Threshold Bit Score: 237.17
Threshold Setting Gi: 13638291
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15894906    5 INIPKDsnIIKIPLEEAMPENYLPYAVEVARDRALPDVRDGLKPVHRRIIYGSYMLKAFPDKPYYKSARIVGDILGKYHP 84   Clostridium aceto...
3914263     1 -----------MDIRTVLKDNFLQYSSYVIKDRAIASVVDGFKPVQRRIIHSLFEMH---DGNFHKVANVVGNTM-KYHP 65   Lyme disease spir...
15618626    1 ----------MRDVSELFRTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFLMD---DGKMHKVANIAGRTM-ALHP 66   Chlamydophila pne...
15605393    1 ----------MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMD---DGKMHKVANIAGRTM-ALHP 66   Chlamydia trachom...
19074112  632 pgtfldqsqtqISISDFVNKELILFSMADNI-RSIPSLVDGLKPGQRKVIFSCFKRNLRSEIKVAQLVGYVSEQS--AYH 708  Encephalitozoon c...
1352714     1 MDQKNNn-LFQKAIEEVFAVSFSKYAKYIIQDRALPDLRDGLKPVQRRILYGMFQMGLKPTTPYKKSARAVGEIMGKYHP 79   Mycoplasma genita...
2501298     1 MEKNKQa-LLLQAIEDVFAFSFSKYAKYIIQDRALPDLRDGLKPVQRRILYGMYQMGLKPTSPYKKSARAVGEIMGKYHP 79   Mycoplasma pneumo...
15828844    9 QEQINEk-LISQSLDQIMSDRFGRYSKYIIQQRALPDARDGLKPVQRRILYSMMDLKLWNDKPFKKSARIVGDVIGKYHP 87   Mycoplasma pulmonis
12644105  712 pgiymdytqpqIPIDDFINRELIQFSMADNI-RSIPSVVDGLKPGQRKVVYYCFKRNLVHETKVSRLAGYVASET--AYH 788  fission yeast
13358030    1 MSVNHQk-IINTPLDNIVGESYAKYAKYIIQDRALPDIRDGLKPVQRRILYAMSELGIFYDKPYKKSARTVGEVIGKYHP 79   Ureaplasma urealy...
15894906   85 HGDSSVYESMVILAQNFT--TRHPLIDGHGNWGSVDG--DSAAAMRYTEARLTPIALEMINDIDKDVVDMVDNYSGSEKE 160  Clostridium aceto...
3914263    66 HGDTSIYEALVNIAN------KDLFIEKQGNFGNLFTg-DPASASRYIECRLTPLAFD--VLYSKEITIYESSYDGRNNE 136  Lyme disease spir...
15618626   67 HGDAPIVEALVVLAN------KGYLIDTQGNFGNPLTg-DPHAAARYIEARLSPLARE--TLFNTDLIAFHDSYDGREKE 137  Chlamydophila pne...
15605393   67 HGDAPIVEALVVLAN------KGFLIETQGNFGNPLTg-DPHAAARYIEARLSPLAKE--VLFNTDLMTFHDSYDGREQE 137  Chlamydia trachom...
19074112  709 HGEQSLCSTIVNLAQDFVgsNNINLLLPIGQFGSRLQggKDAASPRYIFTSLSPLTRM-IFNENDDAILNYLNDDNFSIE 787  Encephalitozoon c...
1352714    80 HGDSSIYDAIIRMSQSWK--NNWTTVSIHGNNGSVDG--DNAAAMRYTETRLSLYGFELLKDIDKKLVSFINNFDDSEKE 155  Mycoplasma genita...
2501298    80 HGDASIYDAIVRMSQAWK--NNLTTISIHGNNGSIDG--DNAAAMRYTEARLSPYGFELLKDIEKQLVPFVNNFDDSEVE 155  Mycoplasma pneumo...
15828844   88 HGDSSIYEAMVRMAQDWK--MNIPLIQMHGNIGSIDD--DPAAAMRYTESRLAEISNLMLEGIEKNVVSFAPNFDDSEKE 163  Mycoplasma pulmonis
12644105  789 HGEVSMEQTIVNLAQNFVgsNNINLLMPNGQFGTRSEggKNASASRYLNTALSPLARV-LFNSNDDQLLNYQNDEGQWIE 867  fission yeast
13358030   80 HGDSSIYEAMVRMSQDWK--NNLCLLDMHGNKGSIDG--DNAAAMRYTEARLSKIASVMLANLKKDVVKFSPNFDDSEKE 155  Ureaplasma urealy...
15894906  161 PSVLPAAYPNLLVNGAFGIAVGLSTNIPPHNLREVIDAVLKYIDNKDVTVNELMECVKGPDLPTGGIIIG-KNSLIAAYE 239  Clostridium aceto...
3914263   137 PLLYPAKIPVILIQGSEGIAVGMAAKILPHNFNEILNAVKSELLGESYDIY--------PDFPTGGIVD------VNEYA 202  Lyme disease spir...
15618626  138 PDILPAKLPVLLLHGVDGIAVGMTTKIFPHNFAELLKAQIAILNDKKFTVF--------PDFPSGGLMDP--SE----YQ 203  Chlamydophila pne...
15605393  138 PDILAAKIPLLLLHGVDGIAVGMTTKIFPHNFCDLLEAQIAILNDQPFSLL--------PDFPPGGTMDA--SD----YQ 203  Chlamydia trachom...
19074112  788 PEFYVPIIPMVLVNGAEGIGTGWSTSIPNFNPVDVVENIRRMIRGEDPVEM----------VPYYRNFRGtIEKIGEGKF 857  Encephalitozoon c...
1352714   156 PTVLPTLLPNLFINGASGIAAGYATNIAPHNTNELLDSLCLRIDQPNCELKQILKIVKGPDFPTGGNVYF-EKSLSDIYQ 234  Mycoplasma genita...
2501298   156 PSVLPTLLPNLFINGTSGIAAGYATNIAPHNVGELLDGLSYRIENPDCDLKAILKIVKGPDFPTGGLVYF-EQELANIYQ 234  Mycoplasma pneumo...
15828844  164 PTVLPALIPNLLLNGARGIAAGFATEMPPHNLGEILDAAIAKIRISSLKVEDLIKYIKGPDFPTGGVIHG-LSGIVQAFK 242  Mycoplasma pulmonis
12644105  868 PEYYVPILPMVLVNGAEGIGTGWSTFIPNYNPKDITANLRHMLNGEPLEIM----------TPWYRGFRGsITKVAPDRY 937  fission yeast
13358030  156 PSILPSLFPNLLINGATGIASGYATNIPPHNPNEVFDALIYRIDHPDCSVEKLIEICPAPDFPTGGEIHD-LNGCANAHK 234  Ureaplasma urealy...
15894906  240 TGEGKVTLRARTKIERLENGRLAIVISEFPYRRNKAKILQTISEMTADKKhakiLESISDIRDE-SDRRGIRGVIEFKKS 318  Clostridium aceto...
3914263   203 DGNGKVLVRAKIETIDEK----TIVIRELPFGETTESLISSIEKAIRKN-----YIKVSSINDFtAEN--VAIELSLPRG 271  Lyme disease spir...
15618626  204 DGLGSITLRASIDIINDK--T--LVVKQICPQSTTETLIRSIENAAKRG-----TIKIDTIQDFsTDVP--HIEIKLPKG 272  Chlamydophila pne...
15605393  204 DGLGSIVLRATIDIINDK--T--LLIKEICPSTTTETLIRSIENAAKRG-----IIKIDSIQDFsTDLP--HIEIKLPKG 272  Chlamydia trachom...
19074112  858 QVSGIY--EGDMDLEIT----------ELPVGTWTLNYKEFLES-LVQAG----VAR---DFKEyHTEKTVSFTVKLSKP 917  Encephalitozoon c...
1352714   235 AGKGKFIIQAKYEVN---KNLNQIEITQIPYETLKANIVKQIEEIIFDNK----LSAIESVIDS-SDRNGIRIIIKHKDF 306  Mycoplasma genita...
2501298   235 TGKGKFVIQAKYETNTA-FGQNQIVITEIPYETVKANIVKQIEELISDNK----LSALESVIDS-SDRSGIRIIINHKDF 308  Mycoplasma pneumo...
15828844  243 EGRGRISLTCKYEHIN-LPDKNEILITQIPYGSVKSKIVRDIDEIIVNQK----IDGIKEVLDQ-SDRDGISIAIKLEKK 316  Mycoplasma pulmonis
12644105  938 KISGIINQIGENKVEIT----------ELPIRFWTQDMKEYLEAGLVGTEk---IRKFIVDYEShHGEGNVHFNVTLTEA 1004 fission yeast
13358030  235 TGEGKFIIRACIDFKINDNKINQIIISSIPYETNKALIIKEIEDIIYNKE----VAGLIEVRDE-SDAKGISIIIDTKKD 309  Ureaplasma urealy...
15894906  319 SdeDTVnKILKYLFKKTELQCNINFNMVALADGKPETMGLKTIIGHYVNHRKDIVTRRTKHNLNAA--RKRFNIVEGFIK 396  Clostridium aceto...
3914263   272 V--YAS-EVIEKLYHYTNCQISISVNLLLLSERYPVVYTIKDLIKFHAAHLQKILKMELELQKSKIleKIFYKTLEQIFI 348  Lyme disease spir...
15618626  273 S--RAK-EMLPLLFEHTECQVILYSKPTVIYENKPVECSISEILKLHTTALQGYLEKELLLLQEQLtlDHYHKTLEYIFI 349  Chlamydophila pne...
15605393  273 I--YAK-DLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTLQNYLKKELLILEDSLsrELYHKTLEYLFI 349  Chlamydia trachom...
19074112  918 ----VSn------LKLNSTITVNNMVCFDENLRIKKYATPQEILKEFYGVRLRYYLIRKENMLKVM--REELEKLENKVR 985  Encephalitozoon c...
1352714   307 LpaE---KIMAFLFKHTQLQVNFNLNNTVIANRFPIQIGLLSYLDHFLKFCHELIINKAKYELELA--SKRLEIILGLIK 381  Mycoplasma genita...
2501298   309 LsaD---KIMAFLFKHTQLQVNFNLNNTVIANRCPVRVGLLAYFDQFLAFAHELIINSAKYDLALA--NKRLEIIKGLIK 383  Mycoplasma pneumo...
15828844  317 AnhE---SIMKYLFSKTELQVFYNYNNIAIKNGSPTLLNLNELLDIYIEHLKTINVKILEFDLNKA--RLRLEVVEGFLR 391  Mycoplasma pulmonis
12644105 1005 GmkEALnESLEVKFKLSRTQATSNMIAFDASGRIKKYDSVEDILTEFYEVRLRTYQRRKEHMVNEL--EKRFDRFSNQAR 1082 fission yeast
13358030  310 InlE---NVKNYLYKKTNLEISYNTKFIAIVHRTPTLVNLSTYLDAQINHSLDVINKVDLYDLNKI--LLRIEIVEGLIK 384  Ureaplasma urealy...
15894906  397 AIDIMDEIISTIRASKS-KKDSENNLVAK------------FGFNNEQATAIVELMLYKLTGLEIETFKKEYDELSKLIK 463  Clostridium aceto...
3914263   349 EKKIYKLLETISKEENIlSIILSEVLRHKes--------fsREVLKEDVENLLKIPIRKISLFDIDKNSKDIKILNKELK 420  Lyme disease spir...
15618626  350 KHKLYDSVREVLAINKK--ISADDLHQAVlhalepwlhelaTPVTKQDTSQLASLTIKKILCFNEEACTKELLAIEKKQA 427  Chlamydophila pne...
15605393  350 KHKLYDTVRSMLSKRKTs-PSSSTIHNAVlealtpfldtlpAPD-KQATAQLAALTIKKILCFDENSYEKELACLEKKRS 427  Chlamydia trachom...
19074112  986 FIKEVSMGELVISRRRK--GEVIFDLE------------------SR---------------------------G--YAR 1016 Encephalitozoon c...
1352714   382 AISIIDKIIKLIRSAVD-KSDAREKLIDN------------FKFTFNQAEAIVSLRLYQLTNTDIFELNQEQNELEKTVI 448  Mycoplasma genita...
2501298   384 AVSMIDEIIRLIRRATD-KQDAKTKLIDK------------YAFTLNQAEAIVSLRLYQLTNTDIKVLFAEQKELEQTIQ 450  Mycoplasma pneumo...
15828844  392 VAQITDQIIATIRASNDgKKGVIEDLIRI------------FAFSQRQATAIAELRLYRLSQTDFYLYQNEKEELIKQIN 459  Mycoplasma pulmonis
12644105 1083 FIHMIIEGELVVSKKKK--KDLIVELKEKk-----------FQPISKPKK----------------GHLVDLEVENALAE 1133 fission yeast
13358030  385 CVDLIDEIIKIIRASES-RQDAKNTLIQV------------FNFTNNQAEAIIMMRLHNLTRTDIFDLKNEWQTLQDEAK 451  Ureaplasma urealy...
15894906  464 KLEKILSDEKELLRVVKNELKEVEKKYGEDRRTSIVEDDSEaKIDVEEFTVVEDIVVTMSNDg-YIKSV-PKKTYLRSNs 541  Clostridium aceto...
3914263   421 SINSNISSIRGYSINFIDLLLAKYSKEH-QRKTKISLIK----SKNVKEIATKNMKVYLNlaegFAGTSlFDGEFIGNAs 495  Lyme disease spir...
15618626  428 AIQKDLGRIKEVTVKYLKGLLERHGHLGE-RKTQITNFK----TAKTSILKQQTLI------------------------ 478  Chlamydophila pne...
15605393  428 SVQKDLSQLKKYTVLYIKKLLETYRQLGH-RKTKIAKFDDLp-TERVSAHKKAKELAALDQEenf--------------- 490  Chlamydia trachom...
19074112 1017 ------------ADDYEYLLSMSILSLTVERIERLSN-------EHAKRLSEYNQLMGKTp---KELWLeDLEVFEKE-- 1072 Encephalitozoon c...
1352714   449 SSEQLIASEKARNKLLKKQFEGYKKQFHQQRRSQICGFINQkKVEESELIENKTYGVLITKAgnYHKFE-SNQLLKS--- 524  Mycoplasma genita...
2501298   451 TAERLIAKPQARNQLLQAQFFQYKKQFNQPRRAQIVGLIEKqKVQDSDFIEHKEVGLLISHDgiYFKFE-PEQLAKH--- 526  Mycoplasma pneumo...
15828844  460 DFEKILNSDNELKTYLVNILKKIKKTYPTPRKTQIIDEELKrNYDIEELVVDEKCYVSLSQDg-YLKRV-SSKTFKTND- 536  Mycoplasma pulmonis
12644105 1134 EEQSGDVSQDEDSDAYNYLLSMPLWSLTYERYVELLK-------KKDEVMAELDALIKKTp---KELWLhDLDAFEHA-- 1201 fission yeast
13358030  452 TLQERINSLQVRKNYLKQKMIEFKKTFGFERKTKLFDELVKvEINEDQMIEKQNLNLVISRDg-YIKTV-SKKSFESSK- 528  Ureaplasma urealy...
15894906  542 -dVSDIEYREGDFNRFLIETNTA-------HNLLMFTDE-----GNMYKLRGNSIP-EYKWKEKG-EKIDNLIKgIDLGk 606  Clostridium aceto...
3914263   496 yyDKILVFREnSYVLKNIEDKTFidkknvcALVYDINNSkeqifSIIYFNRLDNFY-YVKRFKIDkFITDKVYEfLGENd 574  Lyme disease spir...
15618626      -------------------------------------------------------------------------------- Chlamydophila pne...
15605393      -------------------------------------------------------------------------------- Chlamydia trachom...
19074112 1073 ---YLRIAEN-EAREYDDELNG-----------CIKKK---------GK-----RPkSRSGISD----RQKKAKvTRKP- 1118 Encephalitozoon c...
1352714   525 --TTDFKSESDTIIFAQTIANT--------DQIFIVTSL-----GNIINIPVYKLA-FNSKNKLA-SLVSKKPI-LLEY- 585  Mycoplasma genita...
2501298   527 --LVEFKSEQDQLIFGGVVQNS--------DYFFMVTSL-----GNIITVPIYKTL-SNTKTKMN-ELLAKKPI-LMED- 587  Mycoplasma pneumo...
15828844  537 --FASFGLKENDNLSFLSKATTK-------DKLLIFSDH-----GNYAIIPIYKIE-EQKSKSFG-VHINDFVY-FNSY- 598  Mycoplasma pulmonis
12644105 1202 ---WNKVMDD-IQREMLEEEQSS-------RDFVNRTKK-----KPRGKSTGTRKPrAIAGSSSS-TAVKKEASsESKP- 1263 fission yeast
13358030  529 --YDELGLKTNDILFYHNIINSH-------DKILIITSK-----AKLINLVAHKIT-SMRWKDVG-EHLNNYVK-FDAN- 590  Ureaplasma urealy...
15894906  607 EKILNIYSVEsl--tEQKDIIFITDRGSLKKTSLDKFDTIY--SKIMALKLKkDEKLIKAELVLRTrEEGFIKVSTEKGL 682  Clostridium aceto...
3914263   575 EFVDFSLN--------PEFVEFSTNKDIVKRIEIDNFMVKSr--SSIGKRIS--SNNLKKVKFK---------------- 626  Lyme disease spir...
15618626      -------------------------------------------------------------------------------- Chlamydophila pne...
15605393      -------------------------------------------------------------------------------- Chlamydia trachom...
19074112 1119 -RSLPVTEHL-------TDSETSQEKPW-KKYNLT--------------------------------------------- 1144 Encephalitozoon c...
1352714   586 ETIVFVGTMNs---vNQPILVLTSKLGMVKRIDLTK-LNIKplKATLCISLRdKDHLVSAFLQQ---DDKLICLVSDHNY 658  Mycoplasma genita...
2501298   588 EKLVLAGIVNpd-kmEQQLLVLTSQCGMVKRVELSKVINTKqiKSSCCMALReRDKLVNAFVQTKG-EPKLVCLVSSSNS 665  Mycoplasma pneumo...
15828844  599 EKIIYVLVVNef--sQDYYISLVTQKGLGKRVSLNKFLITRqsKISNAITLKdDDRLVDVRVSK---GKQNIILFTNFNN 673  Mycoplasma pulmonis
12644105 1264 -STTNRKQQT-------LLEFAASKEPE-KSSDINIVKTEDn-SHGLSVEENrISKSPGLDSSDSG--KSRKRSQSVDSE 1331 fission yeast
13358030  591 EKVIAVYIWNeqfkiDEYQLVLASRLNLIKRIELSELDINKnsKQISIMKLNdNDNLISANLIKKG-HNQFIIAISKLGL 669  Ureaplasma urealy...
15894906  683 DFTVREPLIEEMDRNKMGHQCISVCPMDRIVSSEFVENDDYr---TFGIQINKNGIIKTKASssgNYIDTTTSSTLLIFI 759  Clostridium aceto...
3914263       -------------------------------------------------------------------------------- Lyme disease spir...
15618626      -------------------------------------------------------------------------------- Chlamydophila pne...
15605393      -------------------------------------------------------------------------------- Chlamydia trachom...
19074112      -------------------------------------------------------------------------------- Encephalitozoon c...
1352714   659 YTVFHTNEIPLISSKGMGVKGMKLKLEDQIKFVVAFEANE-----PLVMICSDGSVINLKQT---ELVVVSRMATAKKL- 729  Mycoplasma genita...
2501298   666 FATFLAEEIPIISNKGIGVKGIKLKAEEKVRFAMPLQDND-----ALVVINSDGGVYNFEVV---ELAVASRMSVGKKLI 737  Mycoplasma pneumo...
15828844  674 VVKFSEDALPVISTKGQGNKMIQLSEGEKVSAMSITKTTD-----NLILITNKNNLIKVPTS---HFKFTPRAAKGKRIS 745  Mycoplasma pulmonis
12644105 1332 DAGSKKP-VKKIAASASGRGRKTNKPVATTIFSSDDEDDLLpsslKPSTITSTKASAKNKGK---KASSVKKQSPEDDDD 1407 fission yeast
13358030  670 ALLFLVHEINCLNRLAKGIKIMKLKPNDEVSAILITPNNG-----YNVQLFLERGSKCFNIS---ELKLSKRAATPTNLY 741  Ureaplasma urealy...
15894906  760 DDGRVInIPSYMFKNMDDKvlnlselycefnsnnkiiktlsieefneNKFIYFFSSKGFVKKTKLSEFVESKGIEvcykl 839  Clostridium aceto...
3914263       -------------------------------------------------------------------------------- Lyme disease spir...
15618626      -------------------------------------------------------------------------------- Chlamydophila pne...
15605393      -------------------------------------------------------------------------------- Chlamydia trachom...
19074112      -------------------------------------------------------------------------------- Encephalitozoon c...
1352714   730 PVKKAInY--CFSDAtn---------------------------------tQLINFQGKNG---------SKL------- 758  Mycoplasma genita...
2501298   738 PKTKTPvS--CFAANkh---------------------------------sEIIGHRGKNG---------SDL------- 766  Mycoplasma pneumo...
15828844  746 EELKLGyQKIVLAYNQNlh---------------------------hK-LILVKNELEKIDPSKIVNFKITKLNAdnfff 797  Mycoplasma pulmonis
12644105 1408 DFIIPGsSSTPKASSTNAEpp-------------------------eDSDSPIRKRPTRRA-AATVKTPIYVDPSf---- 1457 fission yeast
13358030  742 PITKKVqN--VLAAFLVah---------------------------eN-VFYLLDQQQKINPYYLSNPKPTKLDTk---- 787  Ureaplasma urealy...
15894906  840 --rnkeDMLVNVDVSENEEEEVVLITKKAmG 868  Clostridium acetobutylicum
3914263       ------------------------------- Lyme disease spirochete
15618626      ------------------------------- Chlamydophila pneumoniae CWL029
15605393      ------------------------------- Chlamydia trachomatis
19074112      ------------------------------- Encephalitozoon cuniculi
1352714   759 ------ITTSELNQMSKTAISQTRFNKLN-- 781  Mycoplasma genitalium
2501298   767 ------FTLNELNRLPKSTVSQMRLFKWS-- 789  Mycoplasma pneumoniae
15828844  798 rqtydfKVKNNLNRISENTSEFSFDQSENnQ 828  Mycoplasma pulmonis
12644105 1458 ------DSMDEPSMQDDSFIVDNDEDVDDyD 1482 fission yeast
13358030  788 ------ISIYENDQMITDVVKDCFLSDEAiS 812  Ureaplasma urealyticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap