Conserved Protein Domain Family
GyrA

?
COG0188: GyrA 
DNA gyrase/topoisomerase IV, subunit A [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223266
View PSSM: COG0188
Aligned: 96 rows
Threshold Bit Score: 237.17
Threshold Setting Gi: 13638291
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906    5 INIPKDsnIIKIPLEEAMPENYLPYAVEVARDRALPDVRDGLKPVHRRIIYGSYMLKAFPDKPYYKSARIVGDILGKYHP 84
gi 3914263     1 -----------MDIRTVLKDNFLQYSSYVIKDRAIASVVDGFKPVQRRIIHSLFEMH---DGNFHKVANVVGNTM-KYHP 65
gi 15618626    1 ----------MRDVSELFRTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFLMD---DGKMHKVANIAGRTM-ALHP 66
gi 15605393    1 ----------MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMD---DGKMHKVANIAGRTM-ALHP 66
gi 19074112  632 pgtfldqsqtqISISDFVNKELILFSMADNI-RSIPSLVDGLKPGQRKVIFSCFKRNLRSEIKVAQLVGYVSEQS--AYH 708
gi 1352714     1 MDQKNNn-LFQKAIEEVFAVSFSKYAKYIIQDRALPDLRDGLKPVQRRILYGMFQMGLKPTTPYKKSARAVGEIMGKYHP 79
gi 2501298     1 MEKNKQa-LLLQAIEDVFAFSFSKYAKYIIQDRALPDLRDGLKPVQRRILYGMYQMGLKPTSPYKKSARAVGEIMGKYHP 79
gi 15828844    9 QEQINEk-LISQSLDQIMSDRFGRYSKYIIQQRALPDARDGLKPVQRRILYSMMDLKLWNDKPFKKSARIVGDVIGKYHP 87
gi 12644105  712 pgiymdytqpqIPIDDFINRELIQFSMADNI-RSIPSVVDGLKPGQRKVVYYCFKRNLVHETKVSRLAGYVASET--AYH 788
gi 13358030    1 MSVNHQk-IINTPLDNIVGESYAKYAKYIIQDRALPDIRDGLKPVQRRILYAMSELGIFYDKPYKKSARTVGEVIGKYHP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906   85 HGDSSVYESMVILAQNFT--TRHPLIDGHGNWGSVDG--DSAAAMRYTEARLTPIALEMINDIDKDVVDMVDNYSGSEKE 160
gi 3914263    66 HGDTSIYEALVNIAN------KDLFIEKQGNFGNLFTg-DPASASRYIECRLTPLAFD--VLYSKEITIYESSYDGRNNE 136
gi 15618626   67 HGDAPIVEALVVLAN------KGYLIDTQGNFGNPLTg-DPHAAARYIEARLSPLARE--TLFNTDLIAFHDSYDGREKE 137
gi 15605393   67 HGDAPIVEALVVLAN------KGFLIETQGNFGNPLTg-DPHAAARYIEARLSPLAKE--VLFNTDLMTFHDSYDGREQE 137
gi 19074112  709 HGEQSLCSTIVNLAQDFVgsNNINLLLPIGQFGSRLQggKDAASPRYIFTSLSPLTRM-IFNENDDAILNYLNDDNFSIE 787
gi 1352714    80 HGDSSIYDAIIRMSQSWK--NNWTTVSIHGNNGSVDG--DNAAAMRYTETRLSLYGFELLKDIDKKLVSFINNFDDSEKE 155
gi 2501298    80 HGDASIYDAIVRMSQAWK--NNLTTISIHGNNGSIDG--DNAAAMRYTEARLSPYGFELLKDIEKQLVPFVNNFDDSEVE 155
gi 15828844   88 HGDSSIYEAMVRMAQDWK--MNIPLIQMHGNIGSIDD--DPAAAMRYTESRLAEISNLMLEGIEKNVVSFAPNFDDSEKE 163
gi 12644105  789 HGEVSMEQTIVNLAQNFVgsNNINLLMPNGQFGTRSEggKNASASRYLNTALSPLARV-LFNSNDDQLLNYQNDEGQWIE 867
gi 13358030   80 HGDSSIYEAMVRMSQDWK--NNLCLLDMHGNKGSIDG--DNAAAMRYTEARLSKIASVMLANLKKDVVKFSPNFDDSEKE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  161 PSVLPAAYPNLLVNGAFGIAVGLSTNIPPHNLREVIDAVLKYIDNKDVTVNELMECVKGPDLPTGGIIIG-KNSLIAAYE 239
gi 3914263   137 PLLYPAKIPVILIQGSEGIAVGMAAKILPHNFNEILNAVKSELLGESYDIY--------PDFPTGGIVD------VNEYA 202
gi 15618626  138 PDILPAKLPVLLLHGVDGIAVGMTTKIFPHNFAELLKAQIAILNDKKFTVF--------PDFPSGGLMDP--SE----YQ 203
gi 15605393  138 PDILAAKIPLLLLHGVDGIAVGMTTKIFPHNFCDLLEAQIAILNDQPFSLL--------PDFPPGGTMDA--SD----YQ 203
gi 19074112  788 PEFYVPIIPMVLVNGAEGIGTGWSTSIPNFNPVDVVENIRRMIRGEDPVEM----------VPYYRNFRGtIEKIGEGKF 857
gi 1352714   156 PTVLPTLLPNLFINGASGIAAGYATNIAPHNTNELLDSLCLRIDQPNCELKQILKIVKGPDFPTGGNVYF-EKSLSDIYQ 234
gi 2501298   156 PSVLPTLLPNLFINGTSGIAAGYATNIAPHNVGELLDGLSYRIENPDCDLKAILKIVKGPDFPTGGLVYF-EQELANIYQ 234
gi 15828844  164 PTVLPALIPNLLLNGARGIAAGFATEMPPHNLGEILDAAIAKIRISSLKVEDLIKYIKGPDFPTGGVIHG-LSGIVQAFK 242
gi 12644105  868 PEYYVPILPMVLVNGAEGIGTGWSTFIPNYNPKDITANLRHMLNGEPLEIM----------TPWYRGFRGsITKVAPDRY 937
gi 13358030  156 PSILPSLFPNLLINGATGIASGYATNIPPHNPNEVFDALIYRIDHPDCSVEKLIEICPAPDFPTGGEIHD-LNGCANAHK 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  240 TGEGKVTLRARTKIERLENGRLAIVISEFPYRRNKAKILQTISEMTADKKhakiLESISDIRDE-SDRRGIRGVIEFKKS 318
gi 3914263   203 DGNGKVLVRAKIETIDEK----TIVIRELPFGETTESLISSIEKAIRKN-----YIKVSSINDFtAEN--VAIELSLPRG 271
gi 15618626  204 DGLGSITLRASIDIINDK--T--LVVKQICPQSTTETLIRSIENAAKRG-----TIKIDTIQDFsTDVP--HIEIKLPKG 272
gi 15605393  204 DGLGSIVLRATIDIINDK--T--LLIKEICPSTTTETLIRSIENAAKRG-----IIKIDSIQDFsTDLP--HIEIKLPKG 272
gi 19074112  858 QVSGIY--EGDMDLEIT----------ELPVGTWTLNYKEFLES-LVQAG----VAR---DFKEyHTEKTVSFTVKLSKP 917
gi 1352714   235 AGKGKFIIQAKYEVN---KNLNQIEITQIPYETLKANIVKQIEEIIFDNK----LSAIESVIDS-SDRNGIRIIIKHKDF 306
gi 2501298   235 TGKGKFVIQAKYETNTA-FGQNQIVITEIPYETVKANIVKQIEELISDNK----LSALESVIDS-SDRSGIRIIINHKDF 308
gi 15828844  243 EGRGRISLTCKYEHIN-LPDKNEILITQIPYGSVKSKIVRDIDEIIVNQK----IDGIKEVLDQ-SDRDGISIAIKLEKK 316
gi 12644105  938 KISGIINQIGENKVEIT----------ELPIRFWTQDMKEYLEAGLVGTEk---IRKFIVDYEShHGEGNVHFNVTLTEA 1004
gi 13358030  235 TGEGKFIIRACIDFKINDNKINQIIISSIPYETNKALIIKEIEDIIYNKE----VAGLIEVRDE-SDAKGISIIIDTKKD 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  319 SdeDTVnKILKYLFKKTELQCNINFNMVALADGKPETMGLKTIIGHYVNHRKDIVTRRTKHNLNAA--RKRFNIVEGFIK 396
gi 3914263   272 V--YAS-EVIEKLYHYTNCQISISVNLLLLSERYPVVYTIKDLIKFHAAHLQKILKMELELQKSKIleKIFYKTLEQIFI 348
gi 15618626  273 S--RAK-EMLPLLFEHTECQVILYSKPTVIYENKPVECSISEILKLHTTALQGYLEKELLLLQEQLtlDHYHKTLEYIFI 349
gi 15605393  273 I--YAK-DLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTLQNYLKKELLILEDSLsrELYHKTLEYLFI 349
gi 19074112  918 ----VSn------LKLNSTITVNNMVCFDENLRIKKYATPQEILKEFYGVRLRYYLIRKENMLKVM--REELEKLENKVR 985
gi 1352714   307 LpaE---KIMAFLFKHTQLQVNFNLNNTVIANRFPIQIGLLSYLDHFLKFCHELIINKAKYELELA--SKRLEIILGLIK 381
gi 2501298   309 LsaD---KIMAFLFKHTQLQVNFNLNNTVIANRCPVRVGLLAYFDQFLAFAHELIINSAKYDLALA--NKRLEIIKGLIK 383
gi 15828844  317 AnhE---SIMKYLFSKTELQVFYNYNNIAIKNGSPTLLNLNELLDIYIEHLKTINVKILEFDLNKA--RLRLEVVEGFLR 391
gi 12644105 1005 GmkEALnESLEVKFKLSRTQATSNMIAFDASGRIKKYDSVEDILTEFYEVRLRTYQRRKEHMVNEL--EKRFDRFSNQAR 1082
gi 13358030  310 InlE---NVKNYLYKKTNLEISYNTKFIAIVHRTPTLVNLSTYLDAQINHSLDVINKVDLYDLNKI--LLRIEIVEGLIK 384
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  397 AIDIMDEIISTIRASKS-KKDSENNLVAK------------FGFNNEQATAIVELMLYKLTGLEIETFKKEYDELSKLIK 463
gi 3914263   349 EKKIYKLLETISKEENIlSIILSEVLRHKes--------fsREVLKEDVENLLKIPIRKISLFDIDKNSKDIKILNKELK 420
gi 15618626  350 KHKLYDSVREVLAINKK--ISADDLHQAVlhalepwlhelaTPVTKQDTSQLASLTIKKILCFNEEACTKELLAIEKKQA 427
gi 15605393  350 KHKLYDTVRSMLSKRKTs-PSSSTIHNAVlealtpfldtlpAPD-KQATAQLAALTIKKILCFDENSYEKELACLEKKRS 427
gi 19074112  986 FIKEVSMGELVISRRRK--GEVIFDLE------------------SR---------------------------G--YAR 1016
gi 1352714   382 AISIIDKIIKLIRSAVD-KSDAREKLIDN------------FKFTFNQAEAIVSLRLYQLTNTDIFELNQEQNELEKTVI 448
gi 2501298   384 AVSMIDEIIRLIRRATD-KQDAKTKLIDK------------YAFTLNQAEAIVSLRLYQLTNTDIKVLFAEQKELEQTIQ 450
gi 15828844  392 VAQITDQIIATIRASNDgKKGVIEDLIRI------------FAFSQRQATAIAELRLYRLSQTDFYLYQNEKEELIKQIN 459
gi 12644105 1083 FIHMIIEGELVVSKKKK--KDLIVELKEKk-----------FQPISKPKK----------------GHLVDLEVENALAE 1133
gi 13358030  385 CVDLIDEIIKIIRASES-RQDAKNTLIQV------------FNFTNNQAEAIIMMRLHNLTRTDIFDLKNEWQTLQDEAK 451
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  464 KLEKILSDEKELLRVVKNELKEVEKKYGEDRRTSIVEDDSEaKIDVEEFTVVEDIVVTMSNDg-YIKSV-PKKTYLRSNs 541
gi 3914263   421 SINSNISSIRGYSINFIDLLLAKYSKEH-QRKTKISLIK----SKNVKEIATKNMKVYLNlaegFAGTSlFDGEFIGNAs 495
gi 15618626  428 AIQKDLGRIKEVTVKYLKGLLERHGHLGE-RKTQITNFK----TAKTSILKQQTLI------------------------ 478
gi 15605393  428 SVQKDLSQLKKYTVLYIKKLLETYRQLGH-RKTKIAKFDDLp-TERVSAHKKAKELAALDQEenf--------------- 490
gi 19074112 1017 ------------ADDYEYLLSMSILSLTVERIERLSN-------EHAKRLSEYNQLMGKTp---KELWLeDLEVFEKE-- 1072
gi 1352714   449 SSEQLIASEKARNKLLKKQFEGYKKQFHQQRRSQICGFINQkKVEESELIENKTYGVLITKAgnYHKFE-SNQLLKS--- 524
gi 2501298   451 TAERLIAKPQARNQLLQAQFFQYKKQFNQPRRAQIVGLIEKqKVQDSDFIEHKEVGLLISHDgiYFKFE-PEQLAKH--- 526
gi 15828844  460 DFEKILNSDNELKTYLVNILKKIKKTYPTPRKTQIIDEELKrNYDIEELVVDEKCYVSLSQDg-YLKRV-SSKTFKTND- 536
gi 12644105 1134 EEQSGDVSQDEDSDAYNYLLSMPLWSLTYERYVELLK-------KKDEVMAELDALIKKTp---KELWLhDLDAFEHA-- 1201
gi 13358030  452 TLQERINSLQVRKNYLKQKMIEFKKTFGFERKTKLFDELVKvEINEDQMIEKQNLNLVISRDg-YIKTV-SKKSFESSK- 528
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  542 -dVSDIEYREGDFNRFLIETNTA-------HNLLMFTDE-----GNMYKLRGNSIP-EYKWKEKG-EKIDNLIKgIDLGk 606
gi 3914263   496 yyDKILVFREnSYVLKNIEDKTFidkknvcALVYDINNSkeqifSIIYFNRLDNFY-YVKRFKIDkFITDKVYEfLGENd 574
gi 15618626      --------------------------------------------------------------------------------
gi 15605393      --------------------------------------------------------------------------------
gi 19074112 1073 ---YLRIAEN-EAREYDDELNG-----------CIKKK---------GK-----RPkSRSGISD----RQKKAKvTRKP- 1118
gi 1352714   525 --TTDFKSESDTIIFAQTIANT--------DQIFIVTSL-----GNIINIPVYKLA-FNSKNKLA-SLVSKKPI-LLEY- 585
gi 2501298   527 --LVEFKSEQDQLIFGGVVQNS--------DYFFMVTSL-----GNIITVPIYKTL-SNTKTKMN-ELLAKKPI-LMED- 587
gi 15828844  537 --FASFGLKENDNLSFLSKATTK-------DKLLIFSDH-----GNYAIIPIYKIE-EQKSKSFG-VHINDFVY-FNSY- 598
gi 12644105 1202 ---WNKVMDD-IQREMLEEEQSS-------RDFVNRTKK-----KPRGKSTGTRKPrAIAGSSSS-TAVKKEASsESKP- 1263
gi 13358030  529 --YDELGLKTNDILFYHNIINSH-------DKILIITSK-----AKLINLVAHKIT-SMRWKDVG-EHLNNYVK-FDAN- 590
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  607 EKILNIYSVEsl--tEQKDIIFITDRGSLKKTSLDKFDTIY--SKIMALKLKkDEKLIKAELVLRTrEEGFIKVSTEKGL 682
gi 3914263   575 EFVDFSLN--------PEFVEFSTNKDIVKRIEIDNFMVKSr--SSIGKRIS--SNNLKKVKFK---------------- 626
gi 15618626      --------------------------------------------------------------------------------
gi 15605393      --------------------------------------------------------------------------------
gi 19074112 1119 -RSLPVTEHL-------TDSETSQEKPW-KKYNLT--------------------------------------------- 1144
gi 1352714   586 ETIVFVGTMNs---vNQPILVLTSKLGMVKRIDLTK-LNIKplKATLCISLRdKDHLVSAFLQQ---DDKLICLVSDHNY 658
gi 2501298   588 EKLVLAGIVNpd-kmEQQLLVLTSQCGMVKRVELSKVINTKqiKSSCCMALReRDKLVNAFVQTKG-EPKLVCLVSSSNS 665
gi 15828844  599 EKIIYVLVVNef--sQDYYISLVTQKGLGKRVSLNKFLITRqsKISNAITLKdDDRLVDVRVSK---GKQNIILFTNFNN 673
gi 12644105 1264 -STTNRKQQT-------LLEFAASKEPE-KSSDINIVKTEDn-SHGLSVEENrISKSPGLDSSDSG--KSRKRSQSVDSE 1331
gi 13358030  591 EKVIAVYIWNeqfkiDEYQLVLASRLNLIKRIELSELDINKnsKQISIMKLNdNDNLISANLIKKG-HNQFIIAISKLGL 669
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  683 DFTVREPLIEEMDRNKMGHQCISVCPMDRIVSSEFVENDDYr---TFGIQINKNGIIKTKASssgNYIDTTTSSTLLIFI 759
gi 3914263       --------------------------------------------------------------------------------
gi 15618626      --------------------------------------------------------------------------------
gi 15605393      --------------------------------------------------------------------------------
gi 19074112      --------------------------------------------------------------------------------
gi 1352714   659 YTVFHTNEIPLISSKGMGVKGMKLKLEDQIKFVVAFEANE-----PLVMICSDGSVINLKQT---ELVVVSRMATAKKL- 729
gi 2501298   666 FATFLAEEIPIISNKGIGVKGIKLKAEEKVRFAMPLQDND-----ALVVINSDGGVYNFEVV---ELAVASRMSVGKKLI 737
gi 15828844  674 VVKFSEDALPVISTKGQGNKMIQLSEGEKVSAMSITKTTD-----NLILITNKNNLIKVPTS---HFKFTPRAAKGKRIS 745
gi 12644105 1332 DAGSKKP-VKKIAASASGRGRKTNKPVATTIFSSDDEDDLLpsslKPSTITSTKASAKNKGK---KASSVKKQSPEDDDD 1407
gi 13358030  670 ALLFLVHEINCLNRLAKGIKIMKLKPNDEVSAILITPNNG-----YNVQLFLERGSKCFNIS---ELKLSKRAATPTNLY 741
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15894906  760 DDGRVInIPSYMFKNMDDKvlnlselycefnsnnkiiktlsieefneNKFIYFFSSKGFVKKTKLSEFVESKGIEvcykl 839
gi 3914263       --------------------------------------------------------------------------------
gi 15618626      --------------------------------------------------------------------------------
gi 15605393      --------------------------------------------------------------------------------
gi 19074112      --------------------------------------------------------------------------------
gi 1352714   730 PVKKAInY--CFSDAtn---------------------------------tQLINFQGKNG---------SKL------- 758
gi 2501298   738 PKTKTPvS--CFAANkh---------------------------------sEIIGHRGKNG---------SDL------- 766
gi 15828844  746 EELKLGyQKIVLAYNQNlh---------------------------hK-LILVKNELEKIDPSKIVNFKITKLNAdnfff 797
gi 12644105 1408 DFIIPGsSSTPKASSTNAEpp-------------------------eDSDSPIRKRPTRRA-AATVKTPIYVDPSf---- 1457
gi 13358030  742 PITKKVqN--VLAAFLVah---------------------------eN-VFYLLDQQQKINPYYLSNPKPTKLDTk---- 787
                        890       900       910
                 ....*....|....*....|....*....|.
gi 15894906  840 --rnkeDMLVNVDVSENEEEEVVLITKKAmG 868
gi 3914263       -------------------------------
gi 15618626      -------------------------------
gi 15605393      -------------------------------
gi 19074112      -------------------------------
gi 1352714   759 ------ITTSELNQMSKTAISQTRFNKLN-- 781
gi 2501298   767 ------FTLNELNRLPKSTVSQMRLFKWS-- 789
gi 15828844  798 rqtydfKVKNNLNRISENTSEFSFDQSENnQ 828
gi 12644105 1458 ------DSMDEPSMQDDSFIVDNDEDVDDyD 1482
gi 13358030  788 ------ISIYENDQMITDVVKDCFLSDEAiS 812
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap