Conserved Protein Domain Family
GyrB

?
COG0187: GyrB 
DNA gyrase/topoisomerase IV, subunit B [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223265
View PSSM: COG0187
Aligned: 93 rows
Threshold Bit Score: 599.884
Threshold Setting Gi: 1351262
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157   12 AESSSYGAASIQILEGLEAVRKRPGMYIGDTSDG----------------------TGLHHLVFEVLDNSIDEALAG-HC 68
gi 3914288     1 MKTQNYDESKIITLSSLEHIRLRSGMYIGRLGDGsn------------------idDGIYVLIKEIIDNSIDEFIMG-YG 61
gi 15618625    1 --MAAYTEASILSLASLDHIRLRAGMYIGRLGNGsq------------------keDGIYTLFKEVVDNGIDEFIMG-HG 59
gi 15605394    2 RKKTAYSESSIISLASLDHIRLRAGMYIGRLGDGsq------------------aeDGIYTLFKEVVDNAIDEFVMG-YG 62
gi 19074112    1 ---MKTIEETYQKKTPVEHILLRPDTYIGSVEKEaqemyvwdeengrmvyksieyvPGLYKIFDEIIVNAADNKIRDpKM 77
gi 15794824    2 AKNNQYSESSITVLKGLEPVKERPGMY----TRT----------------------DSPTHICQEVIDNAADEALGG-FA 54
gi 15677530    2 AKNNQYSESSITVLKGLEPVKERPGMY----TRT----------------------DSPTHICQEVIDNASDEALGG-FA 54
gi 17545695    2 SKTPQYSEASIKVLKGLEPVKQRPGMY----TRT----------------------DNPLHIVQEVIDNAADEALGG-YG 54
gi 12644105   68 GNGNSNVSTQYQRLTPREHVLRRPDTYIGSIEPTtsemwvfdseknkldykavtyvPGLYKIFDEIIVNAADNKVRDpNM 147
gi 15837887    2 NSR--YNAADIEVLTGLDPVKRRPGMY----TDT----------------------TRPNHLAQEVIDNSVDEALAG-YA 52
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157   69 TEIHVTIH-TDNSISVIDNGRGIPTGIKFDDKhepkRSAAEIVMTELHAGGKFDQ----NSYKVSGGLHGVGVSCVNGLS 143
gi 3914288    62 NEIFIKK--ENNLISIRDYGRGIPLGK------------VIESVSVINTGAKYND----DVFQFSVGLNGVGTKAVNALS 123
gi 15618625   60 KSLKISA--SDKQISIQDQGRGIPLGK------------LIDCVSKINTGAKYTQ----DVFHFSVGLNGVGLKAVNALS 121
gi 15605394   63 HTIHITG--DAHELSIRDEGRGIPLGK------------VIDCVSKINTGAKYTQ----DVFHFSVGLNGVGLKAVNALS 124
gi 19074112   78 DVIKVSIDpEGNEISVYNNGKGIPVRIHKEEN----VYVPELIFGNLLTSSNYND----DEKKVTGGRNGYGAKLCNIFS 149
gi 15794824   55 TAIDVQIH-EDGSLSVRDNGRGIPVGLHPEEG----VPVVELVFTRLHAGGKFNKkdggSAYAFSGGLHGVGVSVTNALS 129
gi 15677530   55 TAIDVQIH-EDGSLSVHDNGRGIPVGLHPEEG----VSVVELVFTRLHAGGKFNKkdggSAYAFSGGLHGVGVSVTNALS 129
gi 17545695   55 KWIQVTLH-KDGSVSVEDEARGIPVGIHPEEG----VPVVEIVFTRLHAGGKFDKgr-ggAYAFSGGLHGVGVSVTNALS 128
gi 12644105  148 NTLKVTLDpEANVISIYNNGKGIPIEIHDKEK----IYIPELIFGNLLTSSNYDD----NQKKVTGGRNGYGAKLCNIFS 219
gi 15837887   53 NRIEVTLY-KDGSCEVADNGRGMPVDIHPEEK----IPGVELILTRLHAGGKFSNr----nYTFSGGLHGVGVSVVNALS 123
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  144 KWLKLTVRRD--GRVHHMEFARGIPQnrllepaeapdgktvevSPLRVSGt---TDKRGTEVHFLADEEIFTN---VEYH 215
gi 3914288   124 SKFLVRSTRN--GKSFEALFSKGKLL------------------ESREIKss-dkD--GTYVEFLADSEIFGK---YSYS 177
gi 15618625  122 EIFSVRSVRK--KKYHLATFHRGVLQ------------------ESKQGStk-dpD--GTFVSFTPDPSIFPE---FTFN 175
gi 15605394  125 QHFSVRSVRN--KKFLKASFSKGILL------------------HTEQGAtq-dpD--GTEVVFSPDHELFEN---FSFQ 178
gi 19074112  150 KEFVVETADCevKKYYRQRYRDNMGV-----------------KEDPEISryt--kgdFTKITFKPDLRRFKMtrlDDDI 210
gi 15794824  130 TRLEVTVKRE--GKIHRIVFAGGDVV-----------------EPLA-QVgkcaVKDSGTEVRVWPDGKYFES---PNYS 186
gi 15677530  130 TRLEVTVKRE--GKIHRIVFAGGDVV-----------------EPLA-QVgkcaVKDSGTEVRVWPDGKYFES---PNYS 186
gi 17545695  129 TRLEVAVWRD--GSVSTLAFSGGDVI-----------------EALATRRaergEKKNGTRVRVWPDGKYFDS---ENIP 186
gi 12644105  220 TEFVVETADKerMKKYKQTWYDNMSR-----------------KSEPVITslkk-pdeYTKITFKPDLAKFGMdkiDDDM 281
gi 15837887  124 SKVDLFIKRE--GSEHHMEFREGFAV-----------------SKLK-VLgtvsKKNTGTRLRFWPDSKYFDT---PKFN 180
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  216 YEILSKRIRELSFLNNGVHIKLTDQRT--GKee--dFAFSGGVKGFVEYINKN-------KTVLHPTVFNATGEKd---- 280
gi 3914288   178 EDFLKRRFFHYACLNKGLIINYNDQIFe----------SKNGLLDFLNSEIKSd-------dLLYDIVYYS-SKT----- 234
gi 15618625  176 HDFLKDKIRQYTYLHSGLEIRFNDEVFi----------SHNGLKDLFDAEITEp--------PLYSPLFFQ-NED----- 231
gi 15605394  179 VEFLKKKIRQYTYLHPGLTIIYNGERIv----------STRGLLDLFEEEVQTp--------LLYSPITFQ-HSD----- 234
gi 19074112  211 VALLRKRVYDLAGIVKDVKIFLNEKRIevKG-------FKEYVKLYIPPGAS----------VVHQVINDR--------- 264
gi 15794824  187 IPELERLLRAKAVLLPGVRVSLTRPVKgeDEahtqtWHYPDGLKSYLTDLIADaq---eaVPLFSCENYISDEHNgdf-- 261
gi 15677530  187 IPELERLLRAKAVLLPGVRVSLTRPVKgeDEahtqtWHYPDGLKSYLTDLIADaq---eaVPLFSCENYISDEHNgdf-- 261
gi 17545695  187 QAELQRLLRSKAVLLPGVKVSLTIEKSget----leWQYDQGLRGYLIESLAQgsgadpvIPLFEGEHFADPDRPgeegf 262
gi 12644105  282 VSIIKRRIYDMAGTVRETKVYLNNERIsiSG-------FKKYVEMYLASDTKPde---epPRVIYEHVNDR--------- 342
gi 15837887  181 VRVLRHLLRAKAVLCPGLTVELLEEATgei----ntWHFKDGLRDYLKGEMTE-------SELLPAELFIGCLKKd---- 245
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  281 --GVGVEVSMQWN--DGFNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAkveTSGDDMREGLTCVLS 356
gi 3914288   235 -----LEFAFSHT--NNYGETYFSFVNGQYTNDGGTHQTGFREGFVRAINDFLKKTYSS---------TDIREGLVATLS 298
gi 15618625  232 -----LTFIFSHL--EGNTERYFSFVNGQETLDGGTHLTAFKEAIVKGVNEFFGKTFVS---------NDIREGIVGCIA 295
gi 15605394  235 -----LAFLFSHT--ETSSEQYFSFVNGQETTDGGTHLVAFKEGIVKGVNEFFGKNFSS---------QDIREGLAGCIA 298
gi 19074112  265 -----WELALTTS--EE-QFQQVSFVNGICTTKGGTHVNHVVERIVDPLVEAIQKKEKGLS----VRPFQVRSCMFVFIN 332
gi 15794824  262 siGEGAAFALTWLeeG--SCANESYVNLIPTPLGGTHEAGLKQAVFNAVSNFINLHNLLPRGv-kVQSDDVFGKTAFVLS 338
gi 15677530  262 siGEGAAFALTWLeeG--SCANESYVNLIPTPLGGTHEAGLKQAVFNAVNNFINLHNLLPRGv-kVQSDDVFGKTAFVLS 338
gi 17545695  263 afGEGASWVVAWTdeG--SPVRESYVNLIPTPAGGTHESGLREGLFQAVKSFVEMHALCPKGv-kLMPEDVFARASFVLS 339
gi 12644105  343 -----WDVAFAVS--DG-QFKQVSFVNNISTIRGGTHVNYVANKIVDAIDEVVKKENKKAP----VKAFQIKNYVQVFVN 410
gi 15837887  246 --tEVVDWAVAWVpeG--ELTQESYVNLIPTPQHGTHVNGLRSGLTDALREFCDFRNLLPRGi-kLAPEDVWDRVTFVLS 320
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  357 VKVPEPKFSSQTKDKLVSSEVRLPVEEVVAKALADFLLETPNDAKIICGKIVEAARAREAARKAREMTRRKGvLDGMGLP 436
gi 3914288   299 VKIKDPIFESQTKNKLGNIETRGNVAKEVQKIISEILYKDKILAKLIEKKVVDNERLRKELSSVRKEARERA-KKISFKI 377
gi 15618625  296 IKIASPIFESQTKNKLGNTQIRSSLIKDVKEAIVQALRKDKVAPELLLEKIKFNEKTRKNIQFIKQDLKSKQ-KKVHYKI 374
gi 15605394  299 IKIASPIFESQTKNKLGNTNIRAELAKRVKEAVLSSLKKNPSSAERIQEKIKLNEKTRKNAQFLKQELKDKQ-KKLHYKI 377
gi 19074112  333 SLIDNPAFDSQTKENLTLRASAFGSKCEPMGDFVKSIIKNTPIVQKITSFAKAKQSQQLKKTDGAKTSRLSG---IPKLE 409
gi 15794824  339 ARVLDPQFQGQTKDKLTNRDALKLVATVSGDPLELWLNQNVDFGKKIAELAIRQAQARMR--SVKKIEKKKG-SGVAVLP 415
gi 15677530  339 ARVLDPQFQGQTKDKLTNRDALKLVATVSGDPLELWLNQNVDFGKKIAELAIRQAQARMR--SVKKIEKKKG-SGVAVLP 415
gi 17545695  340 AKVLDPQFQGQIKERLNSRDAVRLVSTFSRPALELWLNQHVEFGKKLAELVIRQAQARTR--AAQKVEKKKG-SGVAVLP 416
gi 12644105  411 CQIENPSFDSQTKETLTTKVSAFGSQCTLSDKFLKAIKKSS-VVEEVLKFATAKADQQLSKGDGGLRSRITG---LTKLE 486
gi 15837887  321 LKMSDPQFSGQTKERLSSRQAAGFIEGTVHDAFSLWLNQNVDIGEQIAQIAIERASARLK--TEKQVTRKKI-THGPALP 397
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  437 GKLADCQ------EKDPALSELFIVEGDSAGGSAKQGR---DRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITAMG 507
gi 3914288   378 PKLKDCKfhfndsSKQSEQTMIFLTEGDSATGSMVSCR---DVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMMVALG 454
gi 15618625  375 PKLRDCKfhyndrSLYGEASSIFLTEGESASASILASR---NPLTQAVFSLRGKPMNVFSLEETKMYKNDELFYLATALG 451
gi 15605394  378 PKLRDCKfhltdnSLYGKNSSIFITEGESASASILASR---NPLTQAVFSLRGKPMNVFSSKEETIYKNDELFYLTTALG 454
gi 19074112  410 DANFAGT-------SRSKDCTLILTEGDSAKTLAVAGLsvvGRDAYGVFPLRGKLLNVREASHKQIMENAEISSIKKILG 482
gi 15794824  416 GKLTDCE------SEDIRENELFLVEGDSAGGSAKLAR---DKATQAILPLRGKVLNSFEVHPDQLFGNAEIHDISVAIG 486
gi 15677530  416 GKLTDCE------SEDIRENELFLVEGDSAGGSAKLAR---DKATQAILPLRGKVLNSFEVHPDQLFGNAEIHDISVAIG 486
gi 17545695  417 GKLTDCE------SDDVSRNELFLVEGDSAGGSAKMGR---DKEFQAILPLRGKVLNTWETERDRLFANNEVHDIAVAIG 487
gi 12644105  487 DANKAGT-------KESHKCVLILTEGDSAKSLAVSGLsvvGRDYYGVFPLRGKLLNVREASHSQILNNKEIQAIKKIMG 559
gi 15837887  398 GKLADCI------SLDLSRTELFLVEGDSAGGSAKQAR---DKDFQAILPLRGKILNTWEVASGNVLASDEVHNLAIAIG 468
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  508 TGIGKDd--YNLDKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPEIIER-GHVYIAQPPLYKIKH---GKEE----RY 577
gi 3914288   455 IEES-------IENLRYNKVVIATDADFDGFHIRNLLLTFFLTFFEDLILN-GHMYILETPLFRVRN---KKIT----TY 519
gi 15618625  452 ITQNE------IQHLRYNKVILATDADVDGMHIRNLLITFFLKTLLPLVEN-NHLFILETPLFKVRN---KTTT----LY 517
gi 15605394  455 LHKDS------LQNLRYNQVILATDADVDGMHIRNLMITFFLKTFLPLVAS-NHLFILETPLFKVRH---KDAT----FY 520
gi 19074112  483 LQHNKVy--EDVSSLRYGHVMIMTDQDHDGSHIKGLIINFLDHFYPSLLKIpGFLQEFITPIIRATKkgqVRd-----FF 555
gi 15794824  487 VDPHGIndhPDLSGLRYGKIAILSDADVDGSHIQVLLLTLFYRHFPKLVAD-GHIYVAQPPLFRVDVnaqGKSKparkFY 565
gi 15677530  487 VDPHGIndhPDLSGLRYGKIAILSDADVDGSHIQVLLLTLFYRHFPKLVAD-GHIYVAQPPLFRVDVnaqGKSKparkFY 565
gi 17545695  488 VDPHGPadsVDLSGLRYGKICILSDADVDGAHIQVLLLTLFFKHFPQLIGR-GNVCVARPPLYRVDAparGK-KpaqkLY 565
gi 12644105  560 FTHKKTy--TDVKGLRYGHLMIMTDQDHDGSHIKGLIINYLESSYPSLLQIpGFLIQFITPIIKCTRgnqVQa-----FY 632
gi 15837887  469 CDPg----kDNLSGLRYGKVVILADADSDGLHIATLLTALFLKHFPALVAA-GHVFVAMPPLFRVDV---GKq----vFY 536
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  578 IKDDVEmaaylmrqaldtailvradgteiasdalaelarqyqfSRAVIERLSRvidadalraiaegvaldlsseagaeas 657
gi 3914288   520 CYSEEE-------------------------------------KQKAILEL-Kg-------------------------- 535
gi 15618625  518 YYSEQE-------------------------------------KMQALQQFGKk-------------------------- 534
gi 15605394  521 CYSEEE-------------------------------------KLSTIEHIGKk-------------------------- 537
gi 19074112  556 TLPEYE-------------------------------------EFKKNED------------------------------ 568
gi 15794824  566 ALDQNE-------------------------------------LDGILERLQKeg------------------------- 583
gi 15677530  566 ALDQNE-------------------------------------LDSILERLQKeg------------------------- 583
gi 17545695  566 ALDDGE-------------------------------------LEAIEDKLRKeg------------------------- 583
gi 12644105  633 TLPEYE-------------------------------------YWKEANNNGR--------------------------- 648
gi 15837887  537 ALDDEE-------------------------------------KTMLLEKIKRe-------------------------- 553
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  658 akalkarllemqgnassanggatadafmqydekhekyrvmvvrrqhgnqrlshidadfvagadyatlsqtaqtfqglige 737
gi 3914288       --------------------------------------------------------------------------------
gi 15618625      --------------------------------------------------------------------------------
gi 15605394      --------------------------------------------------------------------------------
gi 19074112      --------------------------------------------------------------------------------
gi 15794824      --------------------------------------------------------------------------------
gi 15677530      --------------------------------------------------------------------------------
gi 17545695      --------------------------------------------------------------------------------
gi 12644105      --------------------------------------------------------------------------------
gi 15837887      --------------------------------------------------------------------------------
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548157  738 gakvrrgtgdkqreqgvtdfhaaitwllgeAeRGISRQRYKGLGEMNPSQLWETTMDVTQRRLLKVQIEDAIA--ADQIF 815
gi 3914288   536 ---------------------------------GCEVTRFKGLGEISP-NEFKGFIDINSIKLTKVDLFNIKE--IKEKL 579
gi 15618625  535 -------------------------------dSSLEITRFKGLGEISP-KEFAAFIGP-EIRLTPVTITSLES--ISSIL 579
gi 15605394  538 -------------------------------eSSLEITRFKGLGEISP-KEFKSFIGA-DMRLTPVSLPDTET--LDTLL 582
gi 19074112  569 ---------------------------------GWNIKYYKGLGTSTSADAKQYFSNLPVHVKSFTPLAAEDKelIDLAF 615
gi 15794824  584 -----------------------------vKeTAYSISRFKGLGEMNPDQLKDTTMHPDTRRLLQVQIPEGAddeTRDIF 634
gi 15677530  584 -----------------------------vKeTAYSISRFKGLGEMNPDQLKDTTMHPDTRRLLQVQIPEGAddeTRDIF 634
gi 17545695  584 -----------------------------lKeGSWQISRFKGLGEMSAEQLWETTMNPDTRRLLPVSIGEPGaeqTVHVM 634
gi 12644105  649 ---------------------------------GWKIKYYKGLGTSDHDDMKSYFSDLDRHMKYFHAMQEKDAelIEMAF 695
gi 15837887  554 -----------------------------kIkGQVSVTRFKGLGEMNPQQLRESTIHPDTRRLVQLTMDDNt--qTCSLM 602
                        890       900
                 ....*....|....*....|....*...
gi 17548157  816 TTLMGDD-VEPRRNFIESNALVARNIDV 842
gi 3914288   580 GFYMGQN-TPERRNFIMENLI------- 599
gi 15618625  580 QFYMGKN-TKERKQFIMDNLITDF---- 602
gi 15605394  583 QFYMGKN-TKERKLFIIENLVTNL---- 605
gi 19074112  616 NKKKADArKTWLLNFAPGTFLDQSQTQi 643
gi 15794824  635 FKLMGKGeAAARRAWMEREGDTAEL-DI 661
gi 15677530  635 VKLMGKGeAAARRAWMEREGDTAEL-DI 661
gi 17545695  635 NMLMGKGeAGARRTWLEARGNEVEA-DI 661
gi 12644105  696 AKKKADVrKEWLRTYRPGIYMDYTQPQi 723
gi 15837887  603 DMLLAKKrASDRKQWLETKGNLASL-DI 629
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap