Conserved Protein Domain Family
GyrB

?
COG0187: GyrB 
DNA gyrase/topoisomerase IV, subunit B [Replication, recombination and repair]
Statistics
?
PSSM-Id: 223265
View PSSM: COG0187
Aligned: 93 rows
Threshold Bit Score: 599.884
Threshold Setting Gi: 1351262
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17548157   12 AESSSYGAASIQILEGLEAVRKRPGMYIGDTSDG----------------------TGLHHLVFEVLDNSIDEALAG-HC 68   Ralstonia solanac...
3914288     1 MKTQNYDESKIITLSSLEHIRLRSGMYIGRLGDGsn------------------idDGIYVLIKEIIDNSIDEFIMG-YG 61   Lyme disease spir...
15618625    1 --MAAYTEASILSLASLDHIRLRAGMYIGRLGNGsq------------------keDGIYTLFKEVVDNGIDEFIMG-HG 59   Chlamydophila pne...
15605394    2 RKKTAYSESSIISLASLDHIRLRAGMYIGRLGDGsq------------------aeDGIYTLFKEVVDNAIDEFVMG-YG 62   Chlamydia trachom...
19074112    1 ---MKTIEETYQKKTPVEHILLRPDTYIGSVEKEaqemyvwdeengrmvyksieyvPGLYKIFDEIIVNAADNKIRDpKM 77   Encephalitozoon c...
15794824    2 AKNNQYSESSITVLKGLEPVKERPGMY----TRT----------------------DSPTHICQEVIDNAADEALGG-FA 54   Neisseria meningi...
15677530    2 AKNNQYSESSITVLKGLEPVKERPGMY----TRT----------------------DSPTHICQEVIDNASDEALGG-FA 54   Neisseria meningi...
17545695    2 SKTPQYSEASIKVLKGLEPVKQRPGMY----TRT----------------------DNPLHIVQEVIDNAADEALGG-YG 54   Ralstonia solanac...
12644105   68 GNGNSNVSTQYQRLTPREHVLRRPDTYIGSIEPTtsemwvfdseknkldykavtyvPGLYKIFDEIIVNAADNKVRDpNM 147  fission yeast
15837887    2 NSR--YNAADIEVLTGLDPVKRRPGMY----TDT----------------------TRPNHLAQEVIDNSVDEALAG-YA 52   Xylella fastidios...
17548157   69 TEIHVTIH-TDNSISVIDNGRGIPTGIKFDDKhepkRSAAEIVMTELHAGGKFDQ----NSYKVSGGLHGVGVSCVNGLS 143  Ralstonia solanac...
3914288    62 NEIFIKK--ENNLISIRDYGRGIPLGK------------VIESVSVINTGAKYND----DVFQFSVGLNGVGTKAVNALS 123  Lyme disease spir...
15618625   60 KSLKISA--SDKQISIQDQGRGIPLGK------------LIDCVSKINTGAKYTQ----DVFHFSVGLNGVGLKAVNALS 121  Chlamydophila pne...
15605394   63 HTIHITG--DAHELSIRDEGRGIPLGK------------VIDCVSKINTGAKYTQ----DVFHFSVGLNGVGLKAVNALS 124  Chlamydia trachom...
19074112   78 DVIKVSIDpEGNEISVYNNGKGIPVRIHKEEN----VYVPELIFGNLLTSSNYND----DEKKVTGGRNGYGAKLCNIFS 149  Encephalitozoon c...
15794824   55 TAIDVQIH-EDGSLSVRDNGRGIPVGLHPEEG----VPVVELVFTRLHAGGKFNKkdggSAYAFSGGLHGVGVSVTNALS 129  Neisseria meningi...
15677530   55 TAIDVQIH-EDGSLSVHDNGRGIPVGLHPEEG----VSVVELVFTRLHAGGKFNKkdggSAYAFSGGLHGVGVSVTNALS 129  Neisseria meningi...
17545695   55 KWIQVTLH-KDGSVSVEDEARGIPVGIHPEEG----VPVVEIVFTRLHAGGKFDKgr-ggAYAFSGGLHGVGVSVTNALS 128  Ralstonia solanac...
12644105  148 NTLKVTLDpEANVISIYNNGKGIPIEIHDKEK----IYIPELIFGNLLTSSNYDD----NQKKVTGGRNGYGAKLCNIFS 219  fission yeast
15837887   53 NRIEVTLY-KDGSCEVADNGRGMPVDIHPEEK----IPGVELILTRLHAGGKFSNr----nYTFSGGLHGVGVSVVNALS 123  Xylella fastidios...
17548157  144 KWLKLTVRRD--GRVHHMEFARGIPQnrllepaeapdgktvevSPLRVSGt---TDKRGTEVHFLADEEIFTN---VEYH 215  Ralstonia solanac...
3914288   124 SKFLVRSTRN--GKSFEALFSKGKLL------------------ESREIKss-dkD--GTYVEFLADSEIFGK---YSYS 177  Lyme disease spir...
15618625  122 EIFSVRSVRK--KKYHLATFHRGVLQ------------------ESKQGStk-dpD--GTFVSFTPDPSIFPE---FTFN 175  Chlamydophila pne...
15605394  125 QHFSVRSVRN--KKFLKASFSKGILL------------------HTEQGAtq-dpD--GTEVVFSPDHELFEN---FSFQ 178  Chlamydia trachom...
19074112  150 KEFVVETADCevKKYYRQRYRDNMGV-----------------KEDPEISryt--kgdFTKITFKPDLRRFKMtrlDDDI 210  Encephalitozoon c...
15794824  130 TRLEVTVKRE--GKIHRIVFAGGDVV-----------------EPLA-QVgkcaVKDSGTEVRVWPDGKYFES---PNYS 186  Neisseria meningi...
15677530  130 TRLEVTVKRE--GKIHRIVFAGGDVV-----------------EPLA-QVgkcaVKDSGTEVRVWPDGKYFES---PNYS 186  Neisseria meningi...
17545695  129 TRLEVAVWRD--GSVSTLAFSGGDVI-----------------EALATRRaergEKKNGTRVRVWPDGKYFDS---ENIP 186  Ralstonia solanac...
12644105  220 TEFVVETADKerMKKYKQTWYDNMSR-----------------KSEPVITslkk-pdeYTKITFKPDLAKFGMdkiDDDM 281  fission yeast
15837887  124 SKVDLFIKRE--GSEHHMEFREGFAV-----------------SKLK-VLgtvsKKNTGTRLRFWPDSKYFDT---PKFN 180  Xylella fastidios...
17548157  216 YEILSKRIRELSFLNNGVHIKLTDQRT--GKee--dFAFSGGVKGFVEYINKN-------KTVLHPTVFNATGEKd---- 280  Ralstonia solanac...
3914288   178 EDFLKRRFFHYACLNKGLIINYNDQIFe----------SKNGLLDFLNSEIKSd-------dLLYDIVYYS-SKT----- 234  Lyme disease spir...
15618625  176 HDFLKDKIRQYTYLHSGLEIRFNDEVFi----------SHNGLKDLFDAEITEp--------PLYSPLFFQ-NED----- 231  Chlamydophila pne...
15605394  179 VEFLKKKIRQYTYLHPGLTIIYNGERIv----------STRGLLDLFEEEVQTp--------LLYSPITFQ-HSD----- 234  Chlamydia trachom...
19074112  211 VALLRKRVYDLAGIVKDVKIFLNEKRIevKG-------FKEYVKLYIPPGAS----------VVHQVINDR--------- 264  Encephalitozoon c...
15794824  187 IPELERLLRAKAVLLPGVRVSLTRPVKgeDEahtqtWHYPDGLKSYLTDLIADaq---eaVPLFSCENYISDEHNgdf-- 261  Neisseria meningi...
15677530  187 IPELERLLRAKAVLLPGVRVSLTRPVKgeDEahtqtWHYPDGLKSYLTDLIADaq---eaVPLFSCENYISDEHNgdf-- 261  Neisseria meningi...
17545695  187 QAELQRLLRSKAVLLPGVKVSLTIEKSget----leWQYDQGLRGYLIESLAQgsgadpvIPLFEGEHFADPDRPgeegf 262  Ralstonia solanac...
12644105  282 VSIIKRRIYDMAGTVRETKVYLNNERIsiSG-------FKKYVEMYLASDTKPde---epPRVIYEHVNDR--------- 342  fission yeast
15837887  181 VRVLRHLLRAKAVLCPGLTVELLEEATgei----ntWHFKDGLRDYLKGEMTE-------SELLPAELFIGCLKKd---- 245  Xylella fastidios...
17548157  281 --GVGVEVSMQWN--DGFNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAkveTSGDDMREGLTCVLS 356  Ralstonia solanac...
3914288   235 -----LEFAFSHT--NNYGETYFSFVNGQYTNDGGTHQTGFREGFVRAINDFLKKTYSS---------TDIREGLVATLS 298  Lyme disease spir...
15618625  232 -----LTFIFSHL--EGNTERYFSFVNGQETLDGGTHLTAFKEAIVKGVNEFFGKTFVS---------NDIREGIVGCIA 295  Chlamydophila pne...
15605394  235 -----LAFLFSHT--ETSSEQYFSFVNGQETTDGGTHLVAFKEGIVKGVNEFFGKNFSS---------QDIREGLAGCIA 298  Chlamydia trachom...
19074112  265 -----WELALTTS--EE-QFQQVSFVNGICTTKGGTHVNHVVERIVDPLVEAIQKKEKGLS----VRPFQVRSCMFVFIN 332  Encephalitozoon c...
15794824  262 siGEGAAFALTWLeeG--SCANESYVNLIPTPLGGTHEAGLKQAVFNAVSNFINLHNLLPRGv-kVQSDDVFGKTAFVLS 338  Neisseria meningi...
15677530  262 siGEGAAFALTWLeeG--SCANESYVNLIPTPLGGTHEAGLKQAVFNAVNNFINLHNLLPRGv-kVQSDDVFGKTAFVLS 338  Neisseria meningi...
17545695  263 afGEGASWVVAWTdeG--SPVRESYVNLIPTPAGGTHESGLREGLFQAVKSFVEMHALCPKGv-kLMPEDVFARASFVLS 339  Ralstonia solanac...
12644105  343 -----WDVAFAVS--DG-QFKQVSFVNNISTIRGGTHVNYVANKIVDAIDEVVKKENKKAP----VKAFQIKNYVQVFVN 410  fission yeast
15837887  246 --tEVVDWAVAWVpeG--ELTQESYVNLIPTPQHGTHVNGLRSGLTDALREFCDFRNLLPRGi-kLAPEDVWDRVTFVLS 320  Xylella fastidios...
17548157  357 VKVPEPKFSSQTKDKLVSSEVRLPVEEVVAKALADFLLETPNDAKIICGKIVEAARAREAARKAREMTRRKGvLDGMGLP 436  Ralstonia solanac...
3914288   299 VKIKDPIFESQTKNKLGNIETRGNVAKEVQKIISEILYKDKILAKLIEKKVVDNERLRKELSSVRKEARERA-KKISFKI 377  Lyme disease spir...
15618625  296 IKIASPIFESQTKNKLGNTQIRSSLIKDVKEAIVQALRKDKVAPELLLEKIKFNEKTRKNIQFIKQDLKSKQ-KKVHYKI 374  Chlamydophila pne...
15605394  299 IKIASPIFESQTKNKLGNTNIRAELAKRVKEAVLSSLKKNPSSAERIQEKIKLNEKTRKNAQFLKQELKDKQ-KKLHYKI 377  Chlamydia trachom...
19074112  333 SLIDNPAFDSQTKENLTLRASAFGSKCEPMGDFVKSIIKNTPIVQKITSFAKAKQSQQLKKTDGAKTSRLSG---IPKLE 409  Encephalitozoon c...
15794824  339 ARVLDPQFQGQTKDKLTNRDALKLVATVSGDPLELWLNQNVDFGKKIAELAIRQAQARMR--SVKKIEKKKG-SGVAVLP 415  Neisseria meningi...
15677530  339 ARVLDPQFQGQTKDKLTNRDALKLVATVSGDPLELWLNQNVDFGKKIAELAIRQAQARMR--SVKKIEKKKG-SGVAVLP 415  Neisseria meningi...
17545695  340 AKVLDPQFQGQIKERLNSRDAVRLVSTFSRPALELWLNQHVEFGKKLAELVIRQAQARTR--AAQKVEKKKG-SGVAVLP 416  Ralstonia solanac...
12644105  411 CQIENPSFDSQTKETLTTKVSAFGSQCTLSDKFLKAIKKSS-VVEEVLKFATAKADQQLSKGDGGLRSRITG---LTKLE 486  fission yeast
15837887  321 LKMSDPQFSGQTKERLSSRQAAGFIEGTVHDAFSLWLNQNVDIGEQIAQIAIERASARLK--TEKQVTRKKI-THGPALP 397  Xylella fastidios...
17548157  437 GKLADCQ------EKDPALSELFIVEGDSAGGSAKQGR---DRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITAMG 507  Ralstonia solanac...
3914288   378 PKLKDCKfhfndsSKQSEQTMIFLTEGDSATGSMVSCR---DVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMMVALG 454  Lyme disease spir...
15618625  375 PKLRDCKfhyndrSLYGEASSIFLTEGESASASILASR---NPLTQAVFSLRGKPMNVFSLEETKMYKNDELFYLATALG 451  Chlamydophila pne...
15605394  378 PKLRDCKfhltdnSLYGKNSSIFITEGESASASILASR---NPLTQAVFSLRGKPMNVFSSKEETIYKNDELFYLTTALG 454  Chlamydia trachom...
19074112  410 DANFAGT-------SRSKDCTLILTEGDSAKTLAVAGLsvvGRDAYGVFPLRGKLLNVREASHKQIMENAEISSIKKILG 482  Encephalitozoon c...
15794824  416 GKLTDCE------SEDIRENELFLVEGDSAGGSAKLAR---DKATQAILPLRGKVLNSFEVHPDQLFGNAEIHDISVAIG 486  Neisseria meningi...
15677530  416 GKLTDCE------SEDIRENELFLVEGDSAGGSAKLAR---DKATQAILPLRGKVLNSFEVHPDQLFGNAEIHDISVAIG 486  Neisseria meningi...
17545695  417 GKLTDCE------SDDVSRNELFLVEGDSAGGSAKMGR---DKEFQAILPLRGKVLNTWETERDRLFANNEVHDIAVAIG 487  Ralstonia solanac...
12644105  487 DANKAGT-------KESHKCVLILTEGDSAKSLAVSGLsvvGRDYYGVFPLRGKLLNVREASHSQILNNKEIQAIKKIMG 559  fission yeast
15837887  398 GKLADCI------SLDLSRTELFLVEGDSAGGSAKQAR---DKDFQAILPLRGKILNTWEVASGNVLASDEVHNLAIAIG 468  Xylella fastidios...
17548157  508 TGIGKDd--YNLDKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPEIIER-GHVYIAQPPLYKIKH---GKEE----RY 577  Ralstonia solanac...
3914288   455 IEES-------IENLRYNKVVIATDADFDGFHIRNLLLTFFLTFFEDLILN-GHMYILETPLFRVRN---KKIT----TY 519  Lyme disease spir...
15618625  452 ITQNE------IQHLRYNKVILATDADVDGMHIRNLLITFFLKTLLPLVEN-NHLFILETPLFKVRN---KTTT----LY 517  Chlamydophila pne...
15605394  455 LHKDS------LQNLRYNQVILATDADVDGMHIRNLMITFFLKTFLPLVAS-NHLFILETPLFKVRH---KDAT----FY 520  Chlamydia trachom...
19074112  483 LQHNKVy--EDVSSLRYGHVMIMTDQDHDGSHIKGLIINFLDHFYPSLLKIpGFLQEFITPIIRATKkgqVRd-----FF 555  Encephalitozoon c...
15794824  487 VDPHGIndhPDLSGLRYGKIAILSDADVDGSHIQVLLLTLFYRHFPKLVAD-GHIYVAQPPLFRVDVnaqGKSKparkFY 565  Neisseria meningi...
15677530  487 VDPHGIndhPDLSGLRYGKIAILSDADVDGSHIQVLLLTLFYRHFPKLVAD-GHIYVAQPPLFRVDVnaqGKSKparkFY 565  Neisseria meningi...
17545695  488 VDPHGPadsVDLSGLRYGKICILSDADVDGAHIQVLLLTLFFKHFPQLIGR-GNVCVARPPLYRVDAparGK-KpaqkLY 565  Ralstonia solanac...
12644105  560 FTHKKTy--TDVKGLRYGHLMIMTDQDHDGSHIKGLIINYLESSYPSLLQIpGFLIQFITPIIKCTRgnqVQa-----FY 632  fission yeast
15837887  469 CDPg----kDNLSGLRYGKVVILADADSDGLHIATLLTALFLKHFPALVAA-GHVFVAMPPLFRVDV---GKq----vFY 536  Xylella fastidios...
17548157  578 IKDDVEmaaylmrqaldtailvradgteiasdalaelarqyqfSRAVIERLSRvidadalraiaegvaldlsseagaeas 657  Ralstonia solanac...
3914288   520 CYSEEE-------------------------------------KQKAILEL-Kg-------------------------- 535  Lyme disease spir...
15618625  518 YYSEQE-------------------------------------KMQALQQFGKk-------------------------- 534  Chlamydophila pne...
15605394  521 CYSEEE-------------------------------------KLSTIEHIGKk-------------------------- 537  Chlamydia trachom...
19074112  556 TLPEYE-------------------------------------EFKKNED------------------------------ 568  Encephalitozoon c...
15794824  566 ALDQNE-------------------------------------LDGILERLQKeg------------------------- 583  Neisseria meningi...
15677530  566 ALDQNE-------------------------------------LDSILERLQKeg------------------------- 583  Neisseria meningi...
17545695  566 ALDDGE-------------------------------------LEAIEDKLRKeg------------------------- 583  Ralstonia solanac...
12644105  633 TLPEYE-------------------------------------YWKEANNNGR--------------------------- 648  fission yeast
15837887  537 ALDDEE-------------------------------------KTMLLEKIKRe-------------------------- 553  Xylella fastidios...
17548157  658 akalkarllemqgnassanggatadafmqydekhekyrvmvvrrqhgnqrlshidadfvagadyatlsqtaqtfqglige 737  Ralstonia solanac...
3914288       -------------------------------------------------------------------------------- Lyme disease spir...
15618625      -------------------------------------------------------------------------------- Chlamydophila pne...
15605394      -------------------------------------------------------------------------------- Chlamydia trachom...
19074112      -------------------------------------------------------------------------------- Encephalitozoon c...
15794824      -------------------------------------------------------------------------------- Neisseria meningi...
15677530      -------------------------------------------------------------------------------- Neisseria meningi...
17545695      -------------------------------------------------------------------------------- Ralstonia solanac...
12644105      -------------------------------------------------------------------------------- fission yeast
15837887      -------------------------------------------------------------------------------- Xylella fastidios...
17548157  738 gakvrrgtgdkqreqgvtdfhaaitwllgeAeRGISRQRYKGLGEMNPSQLWETTMDVTQRRLLKVQIEDAIA--ADQIF 815  Ralstonia solanac...
3914288   536 ---------------------------------GCEVTRFKGLGEISP-NEFKGFIDINSIKLTKVDLFNIKE--IKEKL 579  Lyme disease spir...
15618625  535 -------------------------------dSSLEITRFKGLGEISP-KEFAAFIGP-EIRLTPVTITSLES--ISSIL 579  Chlamydophila pne...
15605394  538 -------------------------------eSSLEITRFKGLGEISP-KEFKSFIGA-DMRLTPVSLPDTET--LDTLL 582  Chlamydia trachom...
19074112  569 ---------------------------------GWNIKYYKGLGTSTSADAKQYFSNLPVHVKSFTPLAAEDKelIDLAF 615  Encephalitozoon c...
15794824  584 -----------------------------vKeTAYSISRFKGLGEMNPDQLKDTTMHPDTRRLLQVQIPEGAddeTRDIF 634  Neisseria meningi...
15677530  584 -----------------------------vKeTAYSISRFKGLGEMNPDQLKDTTMHPDTRRLLQVQIPEGAddeTRDIF 634  Neisseria meningi...
17545695  584 -----------------------------lKeGSWQISRFKGLGEMSAEQLWETTMNPDTRRLLPVSIGEPGaeqTVHVM 634  Ralstonia solanac...
12644105  649 ---------------------------------GWKIKYYKGLGTSDHDDMKSYFSDLDRHMKYFHAMQEKDAelIEMAF 695  fission yeast
15837887  554 -----------------------------kIkGQVSVTRFKGLGEMNPQQLRESTIHPDTRRLVQLTMDDNt--qTCSLM 602  Xylella fastidios...
17548157  816 TTLMGDD-VEPRRNFIESNALVARNIDV 842  Ralstonia solanacearum
3914288   580 GFYMGQN-TPERRNFIMENLI------- 599  Lyme disease spirochete
15618625  580 QFYMGKN-TKERKQFIMDNLITDF---- 602  Chlamydophila pneumoniae CWL029
15605394  583 QFYMGKN-TKERKLFIIENLVTNL---- 605  Chlamydia trachomatis
19074112  616 NKKKADArKTWLLNFAPGTFLDQSQTQi 643  Encephalitozoon cuniculi
15794824  635 FKLMGKGeAAARRAWMEREGDTAEL-DI 661  Neisseria meningitidis Z2491
15677530  635 VKLMGKGeAAARRAWMEREGDTAEL-DI 661  Neisseria meningitidis MC58
17545695  635 NMLMGKGeAGARRTWLEARGNEVEA-DI 661  Ralstonia solanacearum
12644105  696 AKKKADVrKEWLRTYRPGIYMDYTQPQi 723  fission yeast
15837887  603 DMLLAKKrASDRKQWLETKGNLASL-DI 629  Xylella fastidiosa 9a5c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap