1DG1


Conserved Protein Domain Family
TufB

?
COG0050: TufB 
Click on image for an interactive view with Cn3D
Translation elongation factor EF-Tu, a GTPase [Translation, ribosomal structure and biogenesis]
linked to 3D-structure
Statistics
?
PSSM-Id: 223128
View PSSM: COG0050
Aligned: 73 rows
Threshold Bit Score: 402.446
Threshold Setting Gi: 20094840
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DG1_G     1 MS-KEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTY----GGAARAFDQIDNAPEEKARGITINTSHVEYDTPTR 75  Escherichia coli
15594821   8 MA-KEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKLNkd---aKALKYEDIDNAPEEKARGITINARHIEYETANR 83  Lyme disease spiroc...
119208     1 MA-REKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEg----KSAATRYDEIDKAPEEKARGITINSAHVEYSSDKR 75  Mycoplasma genitalium
2506376    1 MA-REKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEg----KSAATRYDQIDKAPEEKARGITINSAHVEYSSDKR 75  Mycoplasma pneumoniae
15828876   1 MA-KLDFDRSKEHVNIGTIGHVDHGKTTLTAAIATVLSKKg----LAEAKDYASIDAAPEEKARGITINTAHIEYETEKR 75  Mycoplasma pulmonis
11386758  41 YAdEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLG----QASFMDYSQIDKAPEEKARGITISSAHVEYETANR 116 fission yeast
15639180 101 MA-KEKFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKKFg----dKQLKYDEIDNAPEEKARGITINTRHLEYQSDRR 175 Treponema pallidum
1706620    1 MA-KAKFERTKPHVNIGTIGHVDHGKTTLTAAISTVLAKKg----QAIAQSYADVDKTPEERERGITINASHVEYETKTR 75  Ureaplasma parvum
119216    38 YA--AAFDRSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKG----GANFLDYAAIDKAPEERARGITISTAHVEYETAKR 111 baker's yeast
15606942   1 MA-KEKFERTKEHVNVGTIGHVDHGKSTLTSAITCVLAAGLveggKAKCFKYEEIDKAPEEKERGITINITHVEYETAKR 79  Aquifex aeolicus
1DG1_G    76 HYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVD-DEELLELVEMEV 154 Escherichia coli
15594821  84 HYAHVDCPGHADYIKNMITGAAQMDAAILLVAADSGAEPQTKEHLLLAQRMGIKKIIVFLNKLDLAD--PELVELVEVEV 161 Lyme disease spiroc...
119208    76 HYAHVDCPGHADYIKNMITGAAQMDGAILVVSATDSVMPQTREHILLARQVGVPKMVVFLNKCDIAS-DEEVQELVAEEV 154 Mycoplasma genitalium
2506376   76 HYAHVDCPGHADYIKNMITGAAQMDGAILVVSATDSVMPQTREHILLARQVGVPRMVVFLNKCDIAT-DEEVQELVAEEV 154 Mycoplasma pneumoniae
15828876  76 HYAHVDCPGHADYVKNMITGAAQMDGGILVVSATDGPMPQTREHILLSKQVGVPKMVVFLNKVDMLEgEDEMIELVELEI 155 Mycoplasma pulmonis
11386758 117 HYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVVYINKVDMV--EPDMIELVEMEM 194 fission yeast
15639180 176 HYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMPQTKEHLLLARQVGVPSIIVFLNKVDLVD-DPELLELVEEEV 254 Treponema pallidum
1706620   76 HYAHVDCPGHADYVKNMITGAAQMDGAILVIAASDGVMAQTKEHILLARQVGVPKIVVFLNKCDFMT-DPDMQDLVEMEV 154 Ureaplasma parvum
119216   112 HYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDTID-DPEMLELVEMEM 190 baker's yeast
15606942  80 HYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHVLLARQVNVPYIVVFMSKCDMVD-DEELLELVELEV 158 Aquifex aeolicus
1DG1_G   155 RELLSQYDFPGDDTPIVRGSALKALEGDAE-----WEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVT 229 Escherichia coli
15594821 162 LELVEKYGFS-ADTPIIKGSAFGAMSNPEDp---eSTKCVKELLESMDNYFDLPERDIDKPFLLAVEDVFSISGRGTVAT 237 Lyme disease spiroc...
119208   155 RDLLTSYGFDGKNTPIIYGSALKALEGDPK-----WEAKIHDLIKAVDEWIPTPTREVDKPFLLAIEDTMTITGRGTVVT 229 Mycoplasma genitalium
2506376  155 RDLLTSYGFDGKNTPIIYGSALKALEGDPK-----WEAKIHDLMNAVDEWIPTPEREVDKPFLLAIEDTMTITGRGTVVT 229 Mycoplasma pneumoniae
15828876 156 RSLLSEYGFDGDKTPIIKGSALKALEGNPQ-----YEKNIEELMDAVDNYIETPVKELDKPFLLAVEDVFTITGRGTVAT 230 Mycoplasma pulmonis
11386758 195 RELLSEYGFDGDNTPIVSGSALCALEGREPe---iGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVT 271 fission yeast
15639180 255 RDALAGYGFS-RETPIVKGSAFKALQDGASp---eDAACIEELLAAMDSYFEDPVRDDARPFLLSIEDVYTISGRGTVVT 330 Treponema pallidum
1706620  155 RELLSKYGFDGDNTPVIRGSGLKALEGDPV-----WEAKIDELMDAVDSWIPLPERSTDKPFLLAIEDVFTISGRGTVVT 229 Ureaplasma parvum
119216   191 RELLNEYGFDGDNAPIIMGSALCALEGRQPe---iGEQAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVT 267 baker's yeast
15606942 159 RELLSKYEYPGDEVPVIRGSALGALQELEQnspgkWVESIKELLNAMDEYIPTPQREVDKPFLMPIEDVFSISGRGTVVT 238 Aquifex aeolicus
1DG1_G   230 GRVERGIIKVGEEVEIVGIK-ETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESE 308 Escherichia coli
15594821 238 GRIERGIIKVGQEVEIVGIK-ETRKTTVTGVEMFQKILEQGQAGDNVGLLLRGVDKKDIERGQVLSAPGTITPHKKFKAS 316 Lyme disease spiroc...
119208   230 GRVERGELKVGQEVEIVGLKp-IRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVERKEVERGQVLAKPGSIKPHKKFKAE 308 Mycoplasma genitalium
2506376  230 GRVERGELKVGQEIEIVGLRp-IRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVDRKEVERGQVLAKPGSIKPHKKFKAE 308 Mycoplasma pneumoniae
15828876 231 GKVERGQLNINSEVEIVGFTeKPKKTTVTGIEMFRKNLKEAQAGDNAGLLLRGVDRNDVERGQVLAKPGSIVPHSKFEAA 310 Mycoplasma pulmonis
11386758 272 GRVERGTLKKGAEIEIVGYGs-HLKTTVTGIEMFKKQLDAAVAGDNCGLLLRSIKREQLKRGMIVAQPGTVAPHQKFKAS 350 fission yeast
15639180 331 GRIECGVISLNEEVEIVGIK-PTKKTVVTGIEMFNKLLDQGIAGDNVGLLLRGVDKKEVERGQVLSKPGSIKPHTKFEAQ 409 Treponema pallidum
1706620  230 GRVERGVLKVNDEVEIVGLKd-TQKTVVTGIEMFRKSLDQAEAGDNAGILLRGIKKEDVERGQVLVKPGSIKPHRTFTAK 308 Ureaplasma parvum
119216   268 GRVERGNLKKGEELEIVGHNsTPLKTTVTGIEMFRKELDSAMAGDNAGVLLRGIRRDQLKRGMVLAKPGTVKAHTKILAS 347 baker's yeast
15606942 239 GRVERGVLRPGDEVEIVGLReEPLKTVATSIEMFRKVLDEALPGDNIGVLLRGVGRDDVERGQVLAQPGSVKAHKRFRAQ 318 Aquifex aeolicus
1DG1_G   309 VYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG-TIELPEG---VEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTV 384 Escherichia coli
15594821 317 IYCLTKEEGGRHKPFFPGYRPQFFFRTTDVTG-VVAL-EG---KEMVMPGDNVDIIVELISSIAMDKNVEFAVREGGRTV 391 Lyme disease spiroc...
119208   309 IYALKKEEGGRHTGFLNGYRPQFYFRTTDVTG-SIALAEN---TEMVLPGDNASITVELIAPIACEKGSKFSIREGGRTV 384 Mycoplasma genitalium
2506376  309 IYALKKEEGGRHTGFLNGYRPQFYFRTTDVTG-SISLPEN---TEMVLPGDNTSITVELIAPIACEKGSKFSIREGGRTV 384 Mycoplasma pneumoniae
15828876 311 IYALKKEEGGRHTPFFSNYKPQFYFRTTDVTG-GVVFPAG---REMVMPGDNVDLVVELISPIAVEEGTKFSIREGGRTV 386 Mycoplasma pulmonis
11386758 351 FYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVeLTHP-DPndsDKMVMPGDNVEMICTLIHPIVIEKGQRFTVREGGSTV 429 fission yeast
15639180 410 IYVLSKEEGGRHSPFFQGYRPQFYFRTTDITG-TISLPEG---VDMVKPGDNTKIIGELIHPIAMDKGLKLAIREGGRTI 485 Treponema pallidum
1706620  309 VYILKKEEGGRHTPIVSGYRPQFYFRTTDVTG-AISLPAG---VDLVMPGDDVEMTVELIAPVAIEDGSKFSIREGGKTV 384 Ureaplasma parvum
119216   348 LYILSKEEGGRHSGFGENYRPQMFIRTADVTVvMRFPKEVedhSMQVMPGDNVEMECDLIHPTPLEVGQRFNIREGGRTV 427 baker's yeast
15606942 319 VYVLSKEEGGRHTPFFVNYRPQFYFRTADVTGtVVKLPEG---VEMVMPGDNVELEVELIAPVALEEGLRFAIREGGRTV 395 Aquifex aeolicus
1DG1_G   385 GAGVVAKVLS 394 Escherichia coli
15594821 392 ASGRILEILE 401 Lyme disease spirochete
119208   385 GAGTVTEVLE 394 Mycoplasma genitalium
2506376  385 GAGSVTEVLE 394 Mycoplasma pneumoniae
15828876 387 GAGSVTKILK 396 Mycoplasma pulmonis
11386758 430 GTALVTELLD 439 fission yeast
15639180 486 ASGQVTEILL 495 Treponema pallidum
1706620  385 GHGSVIKTSN 394 Ureaplasma parvum
119216   428 GTGLITRIIE 437 baker's yeast
15606942 396 GAGVVTKILD 405 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap