1QCZ


Conserved Protein Domain Family
PurE

?
COG0041: PurE 
Click on image for an interactive view with Cn3D
Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 223119
View PSSM: COG0041
Aligned: 51 rows
Threshold Bit Score: 175.911
Threshold Setting Gi: 20094631
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QCZ_A     6 NPA-----RVAIVXGSKSDWATXQFAAEIFEIL-------------NVPHHVEVVSAHRTPDKLFSFAESAEENGYQVII 67  Escherichia coli
3914487   20 QFRrgegmKAVIIMGSKSDLDYSKKIASKLADF-------------GIDAVMRIASAHKTPEKVLEIIKEYEKEDV-VFV 85  Archaeoglobus fulgidus
15894669   1 -------mKVAIIFGSKSDTEKMKGAATALKEF-------------GVEYKAYVLSAHRVPEKLSEVIKSLENDGFECII 60  Clostridium acetobu...
15792051   1 ------mnFVSILMGSKSDYETMKEAAKTLESF-------------GVKYELIISSAHRSPKRTKEYIANAEEKGVKVFI 61  Campylobacter jejuni
19704324   1 -------mKVGIIFGSKSDVDVMKGAADCLKKF-------------GIEYSAHVLSAHRVPELLEETLEKFEKEDYGVII 60  Fusobacterium nucle...
20090237   1 ------mvDISLIMGSESDRSIANRAVAVLEKS-------------KYTYEVMVISAHRNPEELDSYI-SGSDAKV--FI 58  Methanosarcina acet...
2500014    1 --------MICIIMGSESDLKIAEKAVNILKEF-------------GVEFEVRVASAHRTPELVEEIV-KNSKADV--FI 56  Methanocaldococcus ...
15679392   1 -MNlqmkpRVMILLGSASDFRIAEKAMEIFEEL-------------RIPYDLRVASAHRTHEKVKAIVSEAVKAGVEVFI 66  Methanothermobacter...
15926650   1 -------mKVAVIMGSSSDWKIMQESCNMLDYF-------------EIPYEKQVVSAHRTPKMMVQFASEARERGINIII 60  Staphylococcus aure...
15789832  18 DHPpdetpDVGVIMGSDSDLDVMAGAHDALTDLgfteltdyddpptGYTFESWVVSAHRTPTLMDAYARTAAARGLDVII 97  Halobacterium sp. N...
1QCZ_A    68 AGAGG-AAHLPGXIAAKT-LVPVLGVPVQSAALSGVDSLYSIVQXPRGIPVGTLAIGKAgaANAALLAAQILATHDKELH 145 Escherichia coli
3914487   86 TVAGR-SNALSGFVDANT-SKPVIASPPYSDKFGG-ADIFSSIRMPSGV--APMLVLEA--ENAALAVAKIFALKDEGVR 158 Archaeoglobus fulgidus
15894669  61 AGAGL-AAHLPGVIASQT-TLPVIGVPIN-AAIDGLDSLFSIVQMPKNIPVATVGINNS--YNAGMLAAQILSIKYPEIK 135 Clostridium acetobu...
15792051  62 AAAGM-AAHLAGAVAAYT-TKPVLGVPMSGSNLASMDSLFSTVQMPSGIPVGTLAIGKAgaINAAYLAMQILAIYDVDLA 139 Campylobacter jejuni
19704324  61 AGAGL-AAHLPGVIASKT-VLPVIGVPIK-AAVEGLDALFSIVQMPKSIPVATVAINNS--YNAGMLAVEILAVGNKELR 135 Fusobacterium nucle...
20090237  59 TIAGL-SAALPGVVASRT-KKPVIGVPVS-AKLGGLDALLSIAQMPPGVPVGSVGIDNG--ANGAYLALRILDLIENP-- 131 Methanosarcina acet...
2500014   57 AIAGL-AAHLPGVVASLT-TKPVIAVPVD-AKLDGLDALLSSVQMPPGIPVATVGIDRG--ENAAILALEILALKDENIA 131 Methanocaldococcus ...
15679392  67 GIAGL-SAHLPGMISANT-HRPVIGVPVD-VKLGGLDALFACSQMPFPAPVATVGVDRG--ENAAILAAQIIGIGDPGVR 141 Methanothermobacter...
15926650  61 AGAGG-AAHLPGMVASLT-TLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAgaKNAGILAARMLSIQNPSLV 138 Staphylococcus aure...
15789832  98 AGAGGkSADLPNMTASLAyPIPVVGVPVQ----E--KSVPSVIGMPTGAPITAVDAGKS--YNAGLAAAQFLATDDPTLA 169 Halobacterium sp. N...
1QCZ_A   146 QRLNDWRKAQTDEVLENPDPRGAA 169 Escherichia coli
3914487  159 EKVVQFQENKRREIYKADEELR-- 180 Archaeoglobus fulgidus
15894669 136 EKLVKFRQEMKENFIKDNEEGVQL 159 Clostridium acetobutylicum
15792051 140 QKLKEDRLEKEKKLVSDSKEVEVL 163 Campylobacter jejuni
19704324 136 AKLLEFRKEMKEDFKKN--IYMEL 157 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
20090237     ------------------------ Methanosarcina acetivorans C2A
2500014  132 KKLIEYREKMKKKVYASDEKVKEM 155 Methanocaldococcus jannaschii
15679392 142 ERVADLRRGFYERVRRDECQVLNS 165 Methanothermobacter thermautotrophicus str. Delta H
15926650 139 EKLNQYESSLIQKVEDMQNELQ-- 160 Staphylococcus aureus subsp. aureus N315
15789832 170 DRLRDLQAARQEGVADVSARLHSQ 193 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap