Conserved Protein Domain Family
fabH

?
CHL00203: fabH 
3-oxoacyl-acyl-carrier-protein synthase 3; Provisional
Statistics
?
PSSM-Id: 164577
View PSSM: CHL00203
Aligned: 3 rows
Threshold Bit Score: 586.526
Threshold Setting Gi: 51209851
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465662   1 MGVHILSTGSSVPNFSVENQQFEDIIETSDHWISTRTGIKKRH-LAPSSTSLTKLAAEAANDALSKASINAEDIDLIILA 79 
51209851   2 QGAQIISIGSAVPDLCINNKEISQIVETSDEWIVTRTGIQERRvLTGTNKSVVDLAYSAAMKALDKIHMDPLEIDLIILA 81 
90994387   1 MGVHILSTGSSVPNFSVENQQFEDMIETSDHWISTRTGIKKRH-LAPSSTSLTKLAAEAANKALYAANLKPTEISLIILA 79 
11465662  80 TSTPDDLFGSASQLQAEIGATSSTAFDITAACSGFIIALVTASQFIQAGSYNKVLVVGADTMSRWIDWSDRSSCILFGDG 159
51209851  82 TSSPNDLFGSASQVQAKIGAARAVAFDLTAACSGFVLAIVTATQFIQNGSYKNILIIGADVLSKWIDWSDRKTCILFGDG 161
90994387  80 TSTPDDLFGSASQLQAEIGATTPVAFDITAACSGFIVALVTAAQFIQL-VYDNILVVGADTCLDGLIGQIELPVFYLVMV 158
11465662 160 AGAVLIGESSI--NSILGFKLCTDGRLNSHLQLMNSPsDSQQFGLTTVPKGRYDSIRMNGKEVYKFAVFQVPIVIKNCLN 237
51209851 162 AGAAIIQACYEedNAILGFQLNTDGKQYKKLSITYKE-NNYSLNTLKLFQGQFQYISMNGKEVYKFAVSKVPASIIKCLN 240
90994387 159 LEQLVLGQSLK--NSILGFKLCTDGQLNSHLQLMNKPvNNQKFGGTEIPHGNYNSITMNGKEVYKFAVFQVPTVIRQCLN 236
11465662 238 DVNISIDEVDWFILHQANIRILEAIATRLSIPLSKMITNLENYGNTSAASIPLALDEAIKEKKIQPGQVVVLAGFGAGLT 317
51209851 241 ALHLSIQDVNWLLLHQANKRILQAVANRLSVDNYKIISNLSKYGNTSAASIPLALDEAWQNNQIAKEDIIVISGFGAGLT 320
90994387 237 NLNISIDEVDWFILHQANTRIIEAIASRLSVPFSKMITNLEHYGNTSAASIPLALDEAIQSNKIQPGQIIVLSGFGAGLT 316
11465662 318 WGAIVLKWQ 326
51209851 321 WGTVVIKWK 329
90994387 317 WGAIVLKW- 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap