Conserved Protein Domain Family
ycf39

?
CHL00194: ycf39 
Ycf39; Provisional
Statistics
?
PSSM-Id: 177093
View PSSM: CHL00194
Aligned: 19 rows
Threshold Bit Score: 467.556
Threshold Setting Gi: 11465553
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465553    1 MSLLVIGATSTLGRQIVKKALIQGYEVKCLVRNSKKAAFLKAWGAILVYGDLMVPETLPQCFVGASVIIDVSTVKVKDLN 80 
11467677    1 MSLLVIGATGTLGRQIVRRALDEGYEVSCLVRNLRKAYFLKEWGAELLYGDLSLPETLPTNLTKITAIIDASTARPSDPY 80 
11465704    1 MTLLVIGATGTLGRQIVRRALDEGYNVKCMVRNLRKSAFLKEWGAELVYGDLKLPESILQSFCGVTAVIDASTSRPSDPY 80 
11467300    1 MSILVIGATGTLGRQIVRSALDEGYQVRCLVRNLRKAAFLKEWGAKLIWGDLSQPESLLPALTGIRVIIDTSTSRPTDPA 80 
51209992    1 MSLLVIGATGTLGRQIVRRALDEGFQVKCLVRNFRKAAFLKEWGADLVYGDLKLPETIPPTLLGITAIIDASTARTSDFH 80 
90994429    1 MTLLVIGATGTLGRQIVRRALDEGYNVKCMVRNLRKSAFLKEWGAELIYGDLKLPESILQSFCGVTAIIDASTSRLPDPY 80 
149072067   1 MSLLIIGATGTLGRQIVRRAIDEGYSVKCLVRNLRKAYFLKEWGAELIYGDLSLPETLPLSLKNTTAIIDASTARPSDTY 80 
71842339    1 MTVLVIGGTGTLGRQIVKTALDEGYSVRCLVRNLRRGSFLKDWGAELVYGDLSLPETIPPSFKGVNIVIDAATVRPTDSY 80 
215400778   1 MTLLVVGGTGTLGRQIVRKALDNGFQVRCIVRNKRAAKFLQEWGAELVYGDLTIPETLPLSFQGVTAIIDTSTTRPKDDT 80 
269101002   1 MTLLILGGTGTLGRQIVRKALENGFQVRCIVRNKKAANFLKEWGAELVYGDLTIPETLPFSFQGVTALIDASTTKSEDNS 80 
11465553   81 NDYTVDIYCKRAVLEAAIQAKVKKFVSFSMFNSSQYLDVPSTKIKSDFDRALIKSGINYLIFTPLGFFQDLTSQYAAPIL 160
11467677   81 KAEKIDLEGKIALVEAAKVAGIKRFVFFSVLNAQNYRHLPLVNLKCRMEEYLQTSELEYTTFQLSGFFQGLISQYAIPIL 160
11465704   81 NTEQIDLDGKIALIEAAKAAKVQRFIFFSILNADQYPKVPLMNLKSQVVNYLQKSSISYTVFSLGGFFQGLISQYAIPIL 160
11467300   81 GVYQVDLKGKKALIDAAKAMKIEKFIFFSILNSEKYSQVPLMRIKTVTEELLKESGLNYTIFKLCGFFQGLIGQYAVPIL 160
51209992   81 SATQIDLHGKCILIKSAQKACVRRYIFFSIFASEQYNEIPLMRMKTIIANYLRQSGIDYTIFNLAGFFQGLIVQYALPIL 160
90994429   81 NAEKIDLDGKIALIEAAKAAKVERFIFFSILNSEKYPDVPLMNLKSQVVDFLQKSNVKYIVFSLGGFFQGLINQYAIPIL 160
149072067  81 NAEVIDLKGKIALIEAAKVAGIERFIFFSV-NGEKYSEVPLIELKIKIEEYLKQSNIKYTIFYLGGFFQGLISQYAIPIL 159
71842339   81 SAEKIDWKGKLALIETAKLAQIKKFISFSTVDAAQNSAIPLLDLKLKLVQALEKSNLNYTVFQCSGFFQGLISQYAIPTL 160
215400778  81 KMIEIDWYSKLILIEMAKRINIKRFIFFSILNASQYPSITLMQLKANIEKVLKNSGVPYTIFQCTGFYQALISQYAIPIL 160
269101002  81 ELIHVDWYGKLIVIELAKYTQLKRFIFLSILNSEKYPYITLMQMKYRIEKFIESSTIPFTIFKYAGFFQGLIYQYAIPIL 160
11465553  161 SSQPVFIleQSESVQISYIDARDAANIVLAATSLAFLKNIDFPLIGNRSWNNVSIISLCQLYAGQASPVVTVPLLLVYFI 240
11467677  161 EKQTIWI--TGEYTKINYIDTNDIAKFAVRSLSLNGTIKRTIPLVGLKSWNSEEIIQLCERLSGQKANITKIPLQLLVFF 238
11465704  161 DKKSVWV--TGESTPIAYIDTQDAAKLVIKSLGVPSTENRILPLVGNKAWTSAEIITLCEKLSGQKTQISQIPLSLLKAL 238
11467300  161 DQQTVWI--TTESTSIAYMDTIDIARFTLRSLVLKETNNRVFPLVGTRSWNSADIIQLCERLSGQNAKVTRVPIAFLELA 238
51209992  161 DNQTVWI--ADDSSSVPYIDTQDIAKLAIKSLSTIATKNKILPMVGSKSWNSTEIISLCEKLSGQRSQISRIPLVILVFF 238
90994429  161 DKKSVWV--TGESTPIAYIDTQDAAKLVIKSLGVPSTENRTLPLVGNPAWTSAEIIKLCEKLSGQKTQISQIPIGLLKAL 238
149072067 160 EKQPIWI--TSESTNINYIDTSDVAKFALRSLALKDAECKEFPLVGLKPWNSKEIIQLCERLSGQ-AKITQIPLGGLILL 236
71842339  161 EKQTIWL--LGDMYPAAYIDTQDAAKIVIANLK-EQSSEKIQNLVGVKNWTPQEIVQICERFSGEQAKISYLPSFLLTIL 237
215400778 161 EKKTIWK--TFESVLMSHIDTQDAAKFCIKSLSLKQTENKIFSLGGAKAWSSDEIISLCETLSGQKAEIKEVSLNFLNLL 238
269101002 161 EQKPIII--TLESPTISYIDTQDAAFFCIKSLSIKETKNKIFATGSSQAWRSDEIIELCEKLSGQKAKTQRVPVFIFKLF 238
11465553  241 RRILGFFAFTRQFYFYLTLVENLSRSSYLSFNHENENKFLKIYQKKLFSLEKYFQYYFTHKLGNLKKQI----------- 309
11467677  239 KYLTGFFEWTTNISERLAFAEVLNARQDITSEMASTYSQFGFEPNDITSLESYMQDYFGRILRRLKELSde--------- 309
11465704  239 RKITKTLQWTWNISDRLAFAEVLTSGEIFMAPMNEVYEILSIDKSEVISLEKYFQEYFGKILKVLKDISyeqsq----qd 314
11467300  239 RNTSCFFEWGWNIADRLAFTEVLSKSQFFNSSMDEVYKIFKIESTSTTILESYLQEYFSRILKRLKEINsqqsq----kk 314
51209992  239 RRLTSLFQWSWNISDRLAFTKVLLSNNSFNTSMAEVYDLLQINEQETERLEDYFQEYFSKVMKKLKEISykstsqeneqv 318
90994429  239 RRITKTLQWTWNISDRLAFAEILSSGEQFTAPMDEVYSILGIDRLEVISLEKYLQEYFGKILKVLKDITyeqgq----qd 314
149072067 237 KTITGLFEWGINISERLAFAEVLATGNNFTAEMQSTYDIFAFDKEETITLESYMQDYFGRILRRLKELSde--------- 307
71842339  238 RLILRSLEFTWNIADRLQFSEIKQQNKVVTRT-----------NDNLLTLEQYLQEYFSKILKKLKETSyqq-------- 298
215400778 239 RQITLFFEWTSQISKRLAFVLLLENNEQFIISQDINKQIFKIKPTELTSLETYLREYFEMMLVTLENIDvdsq------n 312
269101002 239 RQITGFFEWSLKISDRLAFIEVINNTQNFTSSINYTYDLLDINKKEILELDFYFREYFEMMLNLLERLNvgqi------k 312
11465553  310 --NNF 312
11467677  310 reRTL 314
11465704  315 neISF 319
11467300  315 ktSDL 319
51209992  319 skKTF 323
90994429  315 neISF 319
149072067 308 keRSL 312
71842339  299 qnTDI 303
215400778 313 kqKDL 317
269101002 313 ktKTS 317
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap