Conserved Protein Domain Family
rplC

?
PRK00001: rplC 
50S ribosomal protein L3
Statistics
?
PSSM-Id: 80437
View PSSM: PRK00001
Aligned: 363 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 27-Aug-2007
Updated: 13-Sep-2007
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK00001 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86158411    1 MSTGLLAKKVGMTQIFTpeGDCVPVTVLEAGPCTVVRRKTAEKDGYDAVVIGFGVVDekhahRLSKPEVGVFKKAG-TPI 79
gi 57238730    1 --MEYIVEKIGMSRTIT--NPSIAVTLL-----RVVNAKVCEVEGGKALVAYPKGKA------SNKCVAGQQKKYNlSAE 65
gi 121613090   1 --MEYIVEKIGMSRTIT--NPSIAVTLLRVVNAKVCEVEGGKA------LVAYPKGK-----ASNKCVAGQQKKYNlSAE 65
gi 15793010    1 --MEYIVEKIGMSRTIT--NPSIAVTLL-----RVVNAKVCEVEGGKALVAYPKGKA------SNKCVAGQQKKYNlSAE 65
gi 109946759   1 --MEFLVQKIGMSRTID--ANSTPVTLLKVLQAKVCQLE----NGKALVAYAMHKKH-------NKAIEGQQKKYQlSKE 65
gi 32266877    3 RTIGTKSEAVTLLRVLG--------------------AKVCEIYDNGKALVAYSQGK-----SVNKAIAGQQKKYSlSKE 57
gi 15612304    1 --MEFLVQKIGMSRTID--ANSTPVTLLKVLQAKVCQLE----NGKALVAYAMHKKY-------NKAIEGQQKKYQlSKE 65
gi 15645932    1 --MEFLVQKIGMSRTID--ANSTPVTLLKVLQAKVCQLE----NGKALVAYAMHKKH-------NKAIEGQQKKYQlSKE 65
gi 108563689   1 --MEFLVQKIGMSRTID--ANSTPVTLLKVLQAKVCQLE----NGKALVAYAMHKKH-------NKAIEGQQKKYQlSKE 65
gi 78776487    1 --MEYIVEKIGMSRTIT--VPSKPVTLLRVLDAKVCEVNE------NSAIVAYKSGK-----KMNKAIEGQQKKYSiSSE 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86158411   80 FRHVKEIRVkdaklLGDLKAGDVLTVDkVFKANQRIDVAGVTKGRGFTGVMKRWNMKGAARdSSTAHeHHRHVGAIGQRK 159
gi 57238730   66 YNRFATLEV------ANTEAGDLDET--PLNEAKILKVSFNTKGRGYSGVMKRHNFAGGPA-SHGSR-FHRRHGSIGNRE 135
gi 121613090  66 YNRFATLEV------ANTEAGDLDET--PLNEAKILKVSFNTKGRGYSGVMKRHNFAGGPA-SHGSR-FHRRHGSIGNRE 135
gi 15793010   66 YNRFATLEV------ANTEAGDLDET--PLNEAKILKVSFNTKGRGYSGVMKRHNFAGGPA-SHGSR-FHRRHGSIGNRE 135
gi 109946759  66 FNHFATLKA-----SQQKELGDLDLS--ALETLKRVKASFKTKGRGFAGVMKRWNFQGGPA-AHGSR-FHRRPGSIGNRE 136
gi 32266877   58 FNRFATLKV------SNKEVGELDVA--SLSEAKRVQVSFKTKGRGFSGAMKRWNFQGGPG-AHGSR-FHRRLGSIGNRE 127
gi 15612304   66 FNHFATLKA-----SQQKELGDLDLS--ALETLKRVKASFKTKGRGFAGVMKRWNFQGGPA-AHGSR-FHRRPGSIGNRE 136
gi 15645932   66 FNHFATLKA-----SQQKELGDLDLS--ALETLKRVKASFKTKGRGFAGVMKRWNFQGGPA-AHGSR-FHRRPGSIGNRE 136
gi 108563689  66 FNHFATLKA-----SQQKELGDLDLS--ALETLKRVKASFKTKGRGFAGVMKRWNFQGGPA-AHGSR-FHRRPGSIGNRE 136
gi 78776487   66 FNRFVTLEV-------ANSEAGDIDLT-PLAEAKVIKATFTTKGRGFTGAMKRWNFSGGPA-EHGHR-FGRRTGSIGNAE 135
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 86158411  160 TPGKVWKGKHLPGHYGVDNITIQNlTVVGIEPEQNVLLVSGAVPGHADGLLFVNTAAK 217
gi 57238730  136 WPGRVQPGMKMAGHYGNTKVTVKN-EVVSYDAENKILVVKGAVPGYNGAMGKIRIAK- 191
gi 121613090 136 WPGRVQPGMKMAGHYGNTKVTVKN-EVVSYDAENKILVVKGAVPGYNGAMGKIR-IAK 191
gi 15793010  136 WPGRVQPGMKMAGHYGNTKVTIKN-EVVSYDAENKILVVKGAVPGYNGAMGKIRIAK- 191
gi 109946759 137 WPGRVQKGRKMAGHYGNELVTCQN-EVLSFDKESMVLVLKGSVAGFSGAYGRIRAL-- 191
gi 32266877  128 WPGRVQPGKKMAGHYGNELVSAKN-DIMSFDKQSAILVLKGSVAGFNGAFGRIQ-IIK 183
gi 15612304  137 WPGRVQKGRKMAGHYGNELVTCQN-EVLSFDKESMVLVLKGSVAGFSGAYGRIRAV-- 191
gi 15645932  137 WPGRVQKGRKMAGHYGNELVTCQN-EVLSFDKESMVLVLKGSVAGFSGAYGRIRAV-- 191
gi 108563689 137 WPGRVQKGRKMAGHYGNELVTCQN-EVLSFDKESMVLVLKGSVAGFSGAYGRIRAV-- 191
gi 78776487  136 WPGRVMKGKKMPGQYGNTQNSVKN-EIISFDAENKIIAVVGSVSGANGSLGRVKVAK- 191
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap