1QLV,1EBL,1DD8,1FJ8,1QFL


Conserved Protein Domain Family
cond_enzymes

?
cd00327: cond_enzymes (this model, PSSM-Id:73194 is obsolete and has been replaced by 238201)
Click on image for an interactive view with Cn3D
Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction. Members are share strong structural similarity, and are involved in the synthesis and degradation of fatty acids, and the production of polyketides, a diverse group of natural products.
Statistics
?
PSSM-Id: 73194
View PSSM: cd00327
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 6-Mar-2002
Updated: 9-Mar-2011
Structure
?
Program:
Drawing:
Aligned Rows:
 
active site
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:location of third residue of catalytic triad differs between different subgroups
  • Structure:1FJ8; E.coli Beta-ketoacyl-[ACP] synthase I with bound inhibitor cerulenin
    View structure with Cn3D
  • Structure:1QFL; Zoogloea ramigera biosynthetic thiolase with bound reaction intermediate
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                      
1QLV_A      25 LAIGTAtppncvaqadyadyyfrvtksehmvdlkekfkricekt-aikkrylaltedylqenptmcefmapslnarqdlv 103  Gerbera hybrid c...
1EBL_A       6 IGTGSYlpeqvrtnadlekxvdtsde--------------------------------------wivtrtgirerhiaap 47   Escherichia coli
P23156      19 TGLGVLsphgtgveahwkavadgtsslgpvtregca------------------hlplrvagevhgfdaaetvedrflvq 80   Streptomyces coe...
1DD8_A       7 TGLGIVssignnqqevlaslregrsgitfsqelkd-------------------sgmrshvwgnvkldttglidrkvvrf 67   Escherichia coli
1FJ8_A       7 TGLGIVssignnqqevlaslregrsgitfsqelkd-------------------sgmrshvwgnvkldttglidrkvvrf 67   Escherichia coli
AAC38075    15 IGSGCRfakgastpeafwellragtdfvgpvpaerwdtaaiydesaaetgttyskvgaflehidrfdahyfgisaseake 94   Pseudomonas fluo...
A39368      17 VGVGMTkfmkpgge-------------------------------------------------------------nsrdy 35   Norway rat
1QFL_A       5 ASAARTavgsfng----------------------------------------------------------------afa 20   Zoogloea ramigera
Feature 1                                                                                      
1QLV_A     104 vtgVPMLGKEAAVKAIDewglp-----kskiTHLIFCTTAGvd----------------------------mpGADYQLV 150  Gerbera hybrid c...
1EBL_A      48 netVSTXGFEAATRAIExagie-----kdqiGLIVVATTSAtha---------------------------fpSAACQIQ 95   Escherichia coli
P23156      81 tdrFTHFALSATQHALAdarfgradvdspysVGVVTAAGSGggefgqrelqnlwghg-srhvgpyqsiawfyaASTGQVS 159  Streptomyces coe...
1DD8_A      68 msdASIYAFLSMEQAIAdaglspeayqnnprVGLIAGSGGGsprfqvfgadamrgprglkavgpyvvtkamasGVSACLA 147  Escherichia coli
1FJ8_A      68 msdASIYAFLSMEQAIAdaglspeayqnnprVGLIAGSGGGsprfqvfgadamrgprglkavgpyvvtkamasGVSACLA 147  Escherichia coli
AAC38075    95 mdpQQRLLLEVACESVAragltre-qlkgsrTAVYVGMLGMdylalhsreagie------qinpyyaagkefsFAAGRIA 167  Pseudomonas fluo...
A39368      36 pdlAKEAGQKALADAQIpys---------avEQACVGYVYGe------------------------------sTCGQRAI 76   Norway rat
1QFL_A      21 ntpAHELGATVISAVLEragva-----agevNEVILGQVLPage---------------------------gqNPARQAA 68   Zoogloea ramigera
Feature 1                        #                                                             
1QLV_A     151 KLLGlspsVKRYMLyqqGXAAGGTVLRLAKDLAEnnkgsRVLIVCSEItailfhgpne---------------------- 208  Gerbera hybrid c...
1EBL_A      96 SXLGik-gCPAFDVa-aACAGFTYALSVADQYVKsgavkYALVVGSDVlartcdp------------------------- 148  Escherichia coli
P23156     160 IRNDf--kGPCGVVa-aDEAGGLDALAHAALAVRng-tdTVVCGATEAplapysivcqlgypelsr-------------- 221  Streptomyces coe...
1DD8_A     148 TPFKi--hGVNYSIs-sACATSAHCIGNAVEQIQlgkqdIVFAGGGEElcwemacefdamgalstk-------------- 210  Escherichia coli
1FJ8_A     148 TPFKi--hGVNYSIs-sACATSAHCIGNAVEQIQlgkqdIVFAGGGEElcwemacefdamgalstk-------------- 210  Escherichia coli
AAC38075   168 YHLGv--hGPAMTVt-tACSSSLVAMHLACRALQageadMALAGGVNLmlapdltiymsqirai---------------- 228  Pseudomonas fluo...
A39368      77 YHSLgltgIPIINVn-nNCSTGSTALFMAQQLVQgglanCVLALGFEKmekgslgtkysdrsnplekhidvlinkygmsa 155  Norway rat
1QFL_A      69 MKAGvpqeATAWGMn-qLXGSGLRAVALGMQQIAtgdasIIVAGGMESmsmaphcahlrggvkmgdfkmidtmikdgltd 147  Zoogloea ramigera
Feature 1                                                                                      
1QLV_A         -------------------------------------------------------------------------------- Gerbera hybrid c...
1EBL_A         -------------------------------------------------------------------------------- Escherichia coli
P23156     222 -------------------------------------------------------------------------------a 222  Streptomyces coe...
1DD8_A     211 ------------------------------------------------------------------------------yn 212  Escherichia coli
1FJ8_A     211 ------------------------------------------------------------------------------yn 212  Escherichia coli
AAC38075       -------------------------------------------------------------------------------- Pseudomonas fluo...
A39368     156 cpfapqlfgsagkehmety---------------------------gtkvehfakigwknhkhsvnnpysqfqdeyslde 208  Norway rat
1QFL_A     148 afygyhmgttaenvakqwqlsrdeqdafavasqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmak 227  Zoogloea ramigera
Feature 1                                                                                      
1QLV_A     209 -------nhldslvaqALFGDGAAALIVGSGphlav---------erpifEIVSTDQTILpdtekamklhlregg----- 267  Gerbera hybrid c...
1EBL_A     149 ----------tdrgtiIIFGDGAGAAVLAASee----------------pGIISTHLHADgsygelltlpnadrvnpens 202  Escherichia coli
P23156     223 tepdrayrpfteaacgFAPAEGGAVLVVEEEaaarer-------gadvraTVAGHAATFTgagrw--------------- 280  Streptomyces coe...
1DD8_A     213 dtpekasrtydahrdgFVIAGGGGMVVVEELehalar-------gahiyaEIVGYGATSDgadmv--------------- 270  Escherichia coli
1FJ8_A     213 dtpekasrtydahrdgFVIAGGGGMVVVEELehalar-------gahiyaEIVGYGATSDgadmv--------------- 270  Escherichia coli
AAC38075   229 -spsgrcrvfdaaadgIVRGEGCGVTVLKRLadalrd-------gdpiqaVIRGSAINQDgasagq-------------- 286  Pseudomonas fluo...
A39368     209 imksrpvfdfltvlqcCPTSDGAAAAIVSSEefvqkhglqskaveivaqeMVTDMPSTFEeksvi--------------- 273  Norway rat
1QFL_A     228 lrpafdkegtvtagnaSGLNDGAAAALLMSEaeasrr-------giqplgRIVSWATVGVdpk----------------- 283  Zoogloea ramigera
Feature 1                                                                                      
1QLV_A     268 -ltfqlhrdvplmvaKNIENAAEKALsplgitdwnsvFWMVHPGGraILDQVERKLnlkedklr---------------- 330  Gerbera hybrid c...
1EBL_A     203 ihltxagnevfkvavTELAHIVDETLaannndrsqldWLVPHQANlrIISATAKKLgxsxdnv----------------- 265  Escherichia coli
P23156     281 -----------aesrEGLARAIQGALaeagcrpeevdVVFADALGvpEADRAEALAladalgphaa-------------r 336  Streptomyces coe...
1DD8_A     271 -----------apsgEGAVRCMKMAMhgvd---tpidYLNSHGTStpVGDVKELAAirevfgdks--------------- 321  Escherichia coli
1FJ8_A     271 -----------apsgEGAVRCMKMAMhgvd---tpidYLNSHGTStpVGDVKELAAirevfgdks--------------- 321  Escherichia coli
AAC38075   287 ----------tvpnaNAQAAVISQALkvaglsvddidYVEAHGTGtpLGDPIELSSldsafqgrer-------------p 343  Pseudomonas fluo...
A39368     274 ----------kmvgyDMSKEAARKCYeksglgpsdvdVIELHDCFstNELLTYEALglcpegqggalvdrgdntyggkwv 343  Norway rat
1QFL_A     284 ------------vmgTGPIPASRKALeragwkigdldLVEANEAFaaQACAVNKDLgwdpsivn---------------- 335  Zoogloea ramigera
Feature 1                 #                                                                    
1QLV_A     331 -asrhvlseYGNLISACVLFIIdEVRKRsmaegkst--------------------------tgegldcGVLFGFGPGMT 383  Gerbera hybrid c...
1EBL_A     266 ---vvtldrHGNTSAASVPCALdEAVRDgrik---------------------------------pgqlVLLEAFGGGFT 309  Escherichia coli
P23156     337 vpvtapktgTGRAYCAAPVLDVaTAVLAmehglipptphvldvch--------dldlvtgrarpaeprtALVLARGLMGS 408  Streptomyces coe...
1DD8_A     322 paisatkamTGHSLGAAGVQEAiYSLLMlehgfiapsinieeldeq------aaglnivtettdrelttVMSNSFGFGGT 395  Escherichia coli
1FJ8_A     322 paisatkamTGHSLGAAGVQEAiYSLLMlehgfiapsinieeldeq------aaglnivtettdrelttVMSNSFGFGGT 395  Escherichia coli
AAC38075   344 lwvgsvkanMGHLDAAAGMASViKTMMVlkhaevpaqlhlaqlnplvdwkrsrlavptaieslpdrprlAGISGFGLSGT 423  Pseudomonas fluo...
A39368     344 inpsgglisKGHPLGATGLAQCaELCWQlrgeagk----------------------------rqvpgaKVALQHNLGLG 395  Norway rat
1QFL_A     336 --vnggaiaIGHPIGASGARILnTLLFEmkrr---------------------------------garkGLATLCIGGGM 380  Zoogloea ramigera
Feature 1            
1QLV_A     384 VETVVL 389  Gerbera hybrid cultivar
1EBL_A     310 WGSALV 315  Escherichia coli
P23156     409 NSALVL 414  Streptomyces coelicolor
1DD8_A     396 NATLVM 401  Escherichia coli
1FJ8_A     396 NATLVM 401  Escherichia coli
AAC38075   424 NVHMIL 429  Pseudomonas fluorescens
A39368     396 GAAVVT 401  Norway rat
1QFL_A     381 GVAMCI 386  Zoogloea ramigera

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap