Conserved Protein Domain Family
TPP_E1_OGDC_like

?
cd02016: TPP_E1_OGDC_like (this model, PSSM-Id:48179 is obsolete and has been replaced by 238974)
Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC). OGDC catalyzes the oxidative decarboxylation of 2-oxoglutarate to succinyl-CoA and carbon dioxide, a key reaction of the tricarboxylic acid cycle.
Statistics
?
PSSM-Id: 48179
View PSSM: cd02016
Aligned: 49 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 1-Dec-2004
Updated: 9-Mar-2011
Structure
?
Aligned Rows:
Hierarchy
?
Display:
 
TPP-binding
Feature 1:TPP-binding site [chemical binding site]
Evidence:
  • Comment:TPP = thiamine pyrophosphate or thiamine diphosphate
  • Comment:Based on known TPP and divalent metal ion binding sites of other family members.
  • Citation:PMID 9665697

cd02016 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd00568:TPP_enzymescd02000:TPP_E1_PDC_ADC_BCADCcd02001:TPP_ComE_PpyrDCcd02002:TPP_BFDCcd02003:TPP_IolDcd02004:TPP_BZL_OCoD_HPCLcd02005:TPP_PDC_IPDCcd02006:TPP_Gclcd02007:TPP_DXScd02008:TPP_IOR_alphacd02009:TPP_SHCHC_synthasecd02010:TPP_ALScd02011:TPP_PKcd02012:TPP_TKcd02013:TPP_Xsc_likecd02014:TPP_POXcd02015:TPP_AHAScd02016:TPP_E1_OGDC_likecd02017:TPP_E1_EcPDC_likecd02018:TPP_PFORcd03371:TPP_PpyrDCcd03372:TPP_ComEcd03375:TPP_OGFORcd03376:TPP_PFOR_porB_likecd03377:TPP_PFOR_PNO345558534035299012803319508083785626972472023251250124446653707342601393668144321754958373022146100487191125642046559750940213668063674911821713526185074914268371370721635312309279223612809653029747083362270834448504049173247570066778717462000004565831651704265230143661402438676784957679265784252110266476944644672415835911488534088385582142524145305810552625084468550322737984215805318345558534035299012803319508083785626972472023251250124446653707342601393668144321754958373022146100487191125642046559750940213668063674911821713526185074914268371370721635312309279223612809653029747083362270834448504049173247570066778717462000004565831651704265230143661402438676784957679265784252110266476944644672415835911488534088385582142524145305810552625084468550322737984215805318
cd02016 Sequence Cluster
cd02016 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd02016 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 730221    258 FESFLSTKFPNDKRFGLEGLESVVPgiKTLVDRSVelGVEDIVLGMAHRGRLNVLSNVVRKPNESIFSEFKGssar-ddi 336
gi 40352990  184 FDHFLATKFSTVKRYGGEGAESMMGffHEMLKMCSfgGVTDVIIGMPHRGRLNLLTGLLQFPPELMFRKMRGlsefpens 263
gi 12803319  176 FDHFLATKFSTVKRYGGEGAESMMGffHELLKMSAysGITDVIIGMPHRGRLNLLTGLLQFPPELMFRKMRGlsefpenf 255
gi 25012444  178 WDNFMALKFPTVKRYGGEGAESMLAffWQLLRDSVqaNIEHVVLAMPHRGRTPLQAALLNMRPAKVFRKLGGasefsedi 257
gi 17549583  171 WERLAADRFAHAKRFSLEGCESLVPllETLFDEAGscGVRQVFLGLPHRGRLNALVNVMGFDAQGMLDRLDPdse---va 247
gi 56269724  182 FDHFLATKFATVKRYGGEGAESMMGffYELFRSSVysGVTDVVMGMPHRGRLNLLTGLLQFPPELMFRKMRGlsefpehs 261
gi 50808378  167 FDRFLATKFATVKRYGGEGAESMMGffHELFKMCAysGVTDIILGMPHRGRLNLLTGLLQLPPELMFRKMRGlsefpens 246
gi 66537073  134 FDQFLAIKFASFKRYSGEGAESMLAfyHEFFKLCAndDLEYIVLCMPHRGRLNFLTGMLNFPLEKLFRKLQGhsefpddv 213
gi 66814432  155 FDQFMQKKFPTFKRYGLEGNESMMVscDSIFRESAknQLKNVVIGMPHRGRLNLLVQMCNYPAKDFFWKVKGnsefsegi 234
gi 72023251    7 FDQFMTTKFATVKRYGGEGAESMMVffHQLFTQAAsdGVEDIILAMPHRGRLNLLMGPLGYSPMVMLKKLRGnpefpphl 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                           #                                           #
gi 730221    337 EGSGDVKYHLGMNYQRptts-gkyVNLSLVANPSHLESQDPVVLGRTRALLHAkndl----------kektKALGVLLHG 405
gi 40352990  264 PSIGDVLSHLTSSVDLdfgs-hrpLHVTMLPNPSHLEAINPVAVGKTRARQQSlsdgdyst--essaqpgdKVVCLQVHG 340
gi 12803319  256 SATGDVLSHLTSSVDLdfga-hhpLHVTMLPNPSHLEAVNPVAVGKTRGRQQSlqdgdysp--dnsaqpgdRVICLQVHG 332
gi 25012444  258 EAMSDVISHFHVSEQLkil--gkkLSFSMVRNPSHLEAANPVAMGKTRSKQQArgegafgd---gsqpfgeHVLNVILHG 332
gi 17549583  248 IAQRDLPYHLGGLAKRttd--ageLTLVLAPNPSHLQSVYPVVCGMARGHLDEhp--------------dtPCLPVMVHG 311
gi 56269724  262 PSIGDVLSHLTSTVELdfga-ghpLHVTMLPNPSHLEAINPVTQGKTRGRQQVkqdgdyst--dphsrpgdKVICLQVHG 338
gi 50808378  247 AAIGDVLSHLTSSVDLdfgs-hrpVHVTLLPNPSHLEAINPVAVGKTRGRQQSlldgdysp--essaqpgdKVICLQVHG 323
gi 66537073  214 ATTGDVISHFVSSTNLnig--qkkLHVTMLRNPSHLEAVNPVSMGKTRGIMQAvkdgayne--dintrwsdKVLNIQIHG 289
gi 66814432  235 LGVGDVTSHIAVSTDLqfnnnkesVHVSLIHNPSHLEAVDPVAAGKTRAKQFYekne-----------ggsESLCLMLHG 303
gi 72023251   87 LCVGDIPTHLWTTVDLdvd--gkaVHLSLIPNPSHLEANIPVGIGKARGRQMSkqegdytldpsfdgchgdKVINVLLHG 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ###                              # #                                            
gi 730221    406 DAAFAGQGVVYETMGFLTLPEYSTGGTIHVITNNQIGFTTDPRFA-RSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNL 484
gi 40352990  341 DASISGQGIVTETFTLSNLPHYRIGGSIHLIVNNQLGYTTPAERG-RSSLYSSDVGKIVGCAVIHVNGDDPEEVLRATRL 419
gi 12803319  333 DASFCGQGIVPETFTLSNLPHFRIGGSVHLIVNNQLGYTTPAERG-RSSLYCSDIGKLVGCAIIHVNGDSPEEVVRATRL 411
gi 25012444  333 DAAFAGQGINQECLNMAYVPHFEVGGSLHLIVNNQVGFTTPGDRG-RSTAYTSDLAKSIQAPVFHVNGDDPEALARVTSL 411
gi 17549583  312 DAAFAGQGVVMETLNLTRRSGYTAGGVVHVIVNNQIGFTTPNVMDvRANDYCTDVTRMVDAPVLHVNADDPEAVLRAARI 391
gi 56269724  339 DASFSGQGIVPETFTLSNLPHYRVGGSIHLIVNNQVGYTTPSERG-RSSLYCSDVGKMVGCAIIHVNGDDAEEVLRATRL 417
gi 50808378  324 DGAFSGQGIVPETLTLSNLPHFRVGGSIHLIVNNQLGYTTPPERG-RSSLYCSDIGKIVGCAVIHVNGDDPEEVVRATRL 402
gi 66537073  290 DAAYAAQGVDQECLALSATPHFEIGGTVHLIINNQLGFTTPTSRG-RSSRYCTDLAKMISAPVIHVNGDDPEMVVRAAKI 368
gi 66814432  304 DAAVAGQGVVTETLQLSQLSGFNIGGCVHVIVNNQIGFTTVPTNG-RSNRYSSDIGKFIGAPIIVVNSQSPEQVEKVSRL 382
gi 72023251  165 DAAFVAQGVIAECFAMANLPHYAVGGSIHLIVNNQIGFTTPSERG-RSSPYSSDIAKMNGNPVIHVNGEDPEAVLSACRL 243
                        250       260       270
                 ....*....|....*....|....*....|....*...
Feature 1                                              
gi 730221    485 AAEWRHKFHTDAIIDVVGWRKHGHNETDQPSFTQPLMY 522
gi 40352990  420 AVEYQRCFRKDVIIDLLCYRQWGHNELDEPFFTNPSMY 457
gi 12803319  412 AFEYQRQFRKDVIIDLLCYRQWGHNELDEPFYTNPIMY 449
gi 25012444  412 AFRYQREFRKDIFIDLNCFRRWGHNELDDPTFTNPLVY 449
gi 17549583  392 ALEYRMEHGADIVIDLLGYRRLGHSEHDLTAVTQPALH 429
gi 56269724  418 AVEYQRRFRKDVIVDLLCYRQWGHNELDEPFFTNPAMY 455
gi 50808378  403 AVEYQRHFRRDVIVDLLCYRQWGHNELDEPFFTNPSMY 440
gi 66537073  369 AFKYQRKFRKDVFVDLNCFRRWGHNELDDPVFTNPVIY 406
gi 66814432  383 AVEYRQKFKKDIIIDLIGWRKFGHNEVDEPSFTQPTMY 420
gi 72023251  244 AVSYRQKFRKDVVVDLLCFRRWGHNEIDDPSFTQPIMY 281

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap