2P0O


Conserved Protein Domain Family
DUF871_N

?
pfam19200: DUF871_N (this model, PSSM-Id:408970 is obsolete and has been replaced by 465993)
DUF871 N-terminal domain
This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
Statistics
?
PSSM-Id: 408970
Aligned: 89 rows
Threshold Bit Score: 229.306
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P0O_A                         5 YGISVFLGE--E-ITNDTIIYIKKXKALGFDGIFTSLHIPEDDtSLYRQRLTDLGAIAKAEKXKIXVDISGEALKRAGFS 81  Enterococcus faecalis V583...
WP_013495044                  10 LGIAIYPGYgpEgTEVAITRLMEEAARRGYTEVFTSLHLPEAPaAAMAEELARLAARARPLGLRLWADVAPPALAALGAT 89  Thermaerobacter marianensis...
jgi:Apar_1197                  3 TGISLYFAS----GYEANAEVVAKAQAAGCHYAFTSLHIPEEEeIDYRTEARKLLELCRKAEINLIADISPVTLSKLGVQ 78  Atopobium parvulum DSM 20469...
jgi:Closa_3774                 3 TGISIYFSN----GMEKNERFIKKAIKNGVKYAFTSLHIPEETgVDYRSDVKKLLTLCRDGGLNLIVDVGPETLEKLGTD 78  [Clostridium] saccharolyticum WM1...
WP_013740776                   3 TGISIYPGL--DnTPKENLQLIESAAKLGITRIFTSLHIPETDhSALKEEFSTIVQAARSHDMEIISDISPETLELLGMR 80  Selenomonas sputigena...
CCC72923                       3 TGISVYPGL--GgTIQEKTARIERAAALGMTRLFTSFHIPETDpAAFRKELQAVLETARQFQFDIVADVSPASAACLGMD 80  Megasphaera elsdenii DSM 20460...
jgi:Acfer_0139                 6 KGISLYPGL--GrPLEENLRRLEKAAELGITRLFLSFHIPETDpAAFDREVEPLLRRARSLGLETVGDLVP--------- 74  Acidaminococcus fermentans DSM 20731...
csisp-ryc-ciber-uv:acin_2305   4 KGISLYPGL--GmTREELVGRVEQAAQKGMTRLFLSFHIPETNeAAFQKDIDALFEAARCYDLNVVGDLVP--------- 72  Acidaminococcus intestini RyC-MR95...
jgi:Sterm_3840                 2 KGISIFPGL--DySVRENVNYMERAFRNGIEYIFTSVHIPEADrKRVKDEFDIILTEAEKRKMKVIVDISKGFFDEFRWE 79  Sebaldella termitidis ATCC 33386...
jgi:Hprae_1316                 2 LGISVYAGL--EiSLEENIQYLEKASKLGIKNVFLSLHIPEVNnN-FINEISTLILKINKLNFNLTADISKKYYDKLDLK 78  Halanaerobium praevalens DSM 2228...
2P0O_A                        82 FDELEPLIELG------VTGLRXDYGITIEQXAHASH---KIDIGLNASTiTLEEVAELKAHQADFSRLEAWHNYYPRPE 152 Enterococcus faecalis V583...
WP_013495044                  90 PDDLKPLADLG------LSALRVDYGYDAAAIATMSRnpyGLDVVLNASTlRSADLDRILAAGARPERLVACHNFYPRPE 163 Thermaerobacter marianensis...
jgi:Apar_1197                 79 K--FDELAELG------ITYVRLDFGFDAAETVELSH---KFHVVFNASTiTKDDISAWRAAGADFTRFAACHNYYPKSY 147 Atopobium parvulum DSM 20469...
jgi:Closa_3774                79 N--IFELKELG------ITHVRLDYGFDAKETVKISQ---DFYVVFNASTiLEEELLEWKRYGADFTRFAACHNFYPKEF 147 [Clostridium] saccharolyticum WM1...
WP_013740776                  81 HFSLSAFQFMG------IHTLRIDYGYGAARVAELSRntqNMRIQLNASTiTGKFLTDLLQENANFDNIDALHNFYPREG 154 Selenomonas sputigena...
CCC72923                      81 RFDPEAIAKLG------ITTVRFDDGFDAAKLAMYSH---LVRVQVNASTlRQSDLEDLQKNEAQMDYIDGLHNFYPRPH 151 Megasphaera elsdenii DSM 20460...
jgi:Acfer_0139                75 ----------GrpvpedLTFLRLDDGYTPEAMAALQKkypDRTLVLNASAlTEDQLETLDRQGVDLGRVAALHNFYPHPH 144 Acidaminococcus fermentans DSM 20731...
csisp-ryc-ciber-uv:acin_2305  73 ----------GrpipeaLTHLRLDDGFTPERIKELQTrypQKTLVLNASTvTEGFLLSLEKAGVDVGCVEALHNFYPRPH 142 Acidaminococcus intestini RyC-MR95...
jgi:Sterm_3840                80 DRR--------------IYALRLDFGFNDNEIVQLSH---KYNIQLNASTvTEDWMKRLMESGLNVSNLTVCHNYYPRNN 142 Sebaldella termitidis ATCC 33386...
jgi:Hprae_1316                79 KFN--------------FEALRLDFGFNNQEIAKISQn-sDYKINLNASTiKESDLKEIIAAGAKLENFEASHNYYPRKE 143 Halanaerobium praevalens DSM 2228...
2P0O_A                       153 TGIGTTFFNEKNRWLKELGLQVFTFVPGDGQTRGPIFAGLPTLEKHR--GQNPFAAAVGLXADPyVDAVYIGDPTISERT 230 Enterococcus faecalis V583...
WP_013495044                 164 TGLSIWWVHHLSSALAARGIRVAAFVPSQHGRRGPLFAGLPTVERHR--SVPPDRAATELLALGcIHTLFFGDPGPSAGE 241 Thermaerobacter marianensis...
jgi:Apar_1197                148 TGLSLERVAQINARLSALGFQIFSFVPGEV-FRGPLYEGLPTVEEHRglSGDALIQAMLSLYDVdSDVVLIGDPDVTEAT 226 Atopobium parvulum DSM 20469...
jgi:Closa_3774               148 TALSLKRTKEMNQRLKYLGFTTMAFVPGNLELRGPLFEGLPTVEEHRkrKDQVLLNMLELYYKGsCDVVLIGDVDVEEKD 227 [Clostridium] saccharolyticum WM1...
WP_013740776                 155 TGLAEATLVRKTAMLHKAGISVGAFVPCHFRRRSPLRCGLPTLEMHR--DFPLSLAARHLAAIG-MDSIFIGDSLPSQGE 231 Selenomonas sputigena...
CCC72923                     152 TGLDLDYFKAQTDLLHAYGLSVGAFVPSQSGQRAPLYEGLPTLEDHR--HQDVSLAARHLAALG-VQSVFIGDDKPSDKE 228 Megasphaera elsdenii DSM 20460...
jgi:Acfer_0139               145 TGLSEEYLLRQNRLFHRYGIPVGAFAASQSGKRGPLGEGLPTLEQAR--HRSVSLAARQLAALG-IDGIYIGDDGPDRQE 221 Acidaminococcus fermentans DSM 20731...
csisp-ryc-ciber-uv:acin_2305 143 TGLSEAFFLRQNALCHHYGIKVGAFVRSFGACRGPLFKGLPTLEIHR--TLDFFLALQHLRLLG-TDAFYIGDDGATEDE 219 Acidaminococcus intestini RyC-MR95...
jgi:Sterm_3840               143 TGISLELLTERNRFFKEAGLKITAFVPGGEFRRGPLYEGLPTVESHR--NVHILACAQELLYAG-TDIIIIGDSMASEKE 219 Sebaldella termitidis ATCC 33386...
jgi:Hprae_1316               144 TGLSEELLIKKNNLLKRYGLKISGFVPAKYKKRPPIKAGLPSLEKHR--FLEPLIAAQDLLSLG-IDKVYIGDSRASKTE 220 Halanaerobium praevalens DSM 2228...
2P0O_A                       231 XAQFGY 236 Enterococcus faecalis V583
WP_013495044                 242 MDAVRA 247 Thermaerobacter marianensis
jgi:Apar_1197                227 WRRIGQ 232 Atopobium parvulum DSM 20469
jgi:Closa_3774               228 WKDIQC 233 [Clostridium] saccharolyticum WM1
WP_013740776                 232 LETLAV 237 Selenomonas sputigena
CCC72923                     229 LRDLAR 234 Megasphaera elsdenii DSM 20460
jgi:Acfer_0139               222 LEALAR 227 Acidaminococcus fermentans DSM 20731
csisp-ryc-ciber-uv:acin_2305 220 LDALAQ 225 Acidaminococcus intestini RyC-MR95
jgi:Sterm_3840               220 LEALGK 225 Sebaldella termitidis ATCC 33386
jgi:Hprae_1316               221 LADFAL 226 Halanaerobium praevalens DSM 2228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap