3W5M


Conserved Protein Domain Family
Bac_rhamnosid6H

?
pfam17389: Bac_rhamnosid6H 
Click on image for an interactive view with Cn3D
Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain
This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
Statistics
?
PSSM-Id: 407469
Aligned: 21 rows
Threshold Bit Score: 331.974
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3W5M_A  597 PFTFEFETNVPMLNKLHSNITWGQRG-NFLSVPTDTPARDERLGWTGDINVFAPTAAYTMESARFLTKWLVDLRDAQTSD 675  Streptomyces avermi...
Q5LHS9  454 ETTGNLETSDPMINRIYKNAYWGIRG-NYRGMPTDCPQRDERMGWLGDRAVGSQGESYIFNNHLLYAKWLDDIEQAQKEN 532  Bacteroides fragili...
Q8A0E5  453 RQTATFECSDADLNAIHNMIQYTMRClTFSGYMVDCPHL-ERAGYGGDGNSSTMSLQTMYDVAPTFTNWIQTWGDSMREG 531  Bacteroides thetaio...
Q7UYB9  401 DDASSFECSDETLNRIWDLCKYSIKAtTFAGVYVDGDR--ERIPYEADAYLNQLSHYSTDDHVTMAARTFDWLME----N 474  Pirellula sp.
Q8A8Z8  476 KKVSTFESSNRIFNAAHRLIEKAVRS-NMQSVFTDCPHR-EKLGWLEQVHLNGPGLLYNYDLTAYAPQIMQNMADAQHPN 553  Bacteroides thetaio...
Q5ATB5  470 RQLGYVKTDRKDVNDLINACYWTFSS-NIFSYHTDCPQI-EKFGWLEVTSLLAPATQYVRDMEAVYSKILDDIIDTQESN 547  Aspergillus nidulans
Q9RK18  696 DEVSSFSCSEPFYEWLDRAMRRTVLN-NLHGIPTDTPMY-EKNGWTGDAQLGTPVMTYAFGMQRFLSKWLGDLADSQNDD 773  Streptomyces coelic...
Q8A4S3  462 PQKGEINTSNPLVNRLWWATNNAYLS-NLMGYPTDCPQR-EKNGWTGDGHFAIETALYNYDGITVYEKWLADHRDEQQPN 539  Bacteroides thetaio...
Q5LID7  462 AEVGSFKCSDQLLNTIFNICRNSYLS-NLFGIPTDCPTR-EKNGWMADGFMVQEAGMFNYDSRNVYAKWVKDMIDTQEAN 539  Bacteroides fragili...
Q8A904  459 DHTGSFSCSDKTLNQVVRNAFWGIRS-NYKGMPVDCPQRNERQPWLGDHAMGSWGESMFFDNHAMYNKWARDIREAQRED 537  Bacteroides thetaio...
3W5M_A  676 GAFTDVAPAVG-------NLGNGVAGWGDAGVTVPWALYQAYGDRQVLADALPSVHAWLRYLEKHSDG------LL--RP 740  Streptomyces avermi...
Q5LHS9  533 GAVPDVAPNYW-------DVCTDNMTWPGAYLIIANMLYDQFGDKQPIIKHYPSMKKWMRYMKDKYMV------DHi-MT 598  Bacteroides fragili...
Q8A0E5  532 GSLAHVGPNP--------GAGGGGPYWCGFIVQAPWRTYVNYNDPRLIKNYYPKMKEWFSYVDKYTVDgllkrwPDtqYR 603  Bacteroides thetaio...
Q7UYB9  475 GTWPT--------------------EWAPHMVFMAHAEWMNSGDTKWLQQRYESLKS--KTLLHRSGDdglvrsDEldRS 532  Pirellula sp.
Q8A8Z8  554 GAMPTTAPEYVvfegpgmDAFAESPEWGGSLVIFPFMYYETYGDDSLIKKYYQHMRRYTDYLKTRADNg---------IL 624  Bacteroides thetaio...
Q5ATB5  548 GLVPTMAPEIRym----cGPLHDTITWGCAIAFLPELIKRYYGSTEVFGKIYQPCIRYMEYMKTKERQg--------gLI 615  Aspergillus nidulans
Q9RK18  774 GQLPVIVPSGGwg----yGDLGPSPEWTTVYPFVVRELYRVYGDERAAREHWETLTRYLDWELGRLRDg---------LA 840  Streptomyces coelic...
Q8A4S3  540 GVLPDIIPTGGw-----gYGTDNGLDWTSTIAIIPWNIYLFYGDSKLLADCYENIKRYVDYVDRTSPSg---------LT 605  Bacteroides thetaio...
Q5LID7  540 GNVAGIAPTSRr-----wDSNWAGPLWDAAIFIVPSYLYRYTGDIETMRQVYPAAERYLKYIETTEDE-------Rg-LI 606  Bacteroides fragili...
Q8A904  538 GCIPDVAPAYW-------NYYSDNVTWPATLPLVCDMLFTNYGDIRPIEDNYPAIKKWISHIREYYMT------KDyiIT 604  Bacteroides thetaio...
3W5M_A  741 ADGYGDWL------------NVSDETPKDVIATAYFAHSADLAARMATELGK-----D-AAPYTDLFTRIRKAFQTAYV- 801  Streptomyces avermi...
Q5LHS9  599 KDNFGDWCmppespelihskDPSRITEAAVLGTTFYYYLSNLMVRFAALAGYp---qD-AEDFRKESELVKEAFNSKYLh 674  Bacteroides fragili...
Q8A0E5  604 DWFLGDWLapi-------gvDAGAQSSVDLVNNCFISECLGTMEKIALMLGEk---eE-AEKFAMRRKNLNELIHQKFYh 672  Bacteroides thetaio...
Q7UYB9  533 RHDIVDWPqk--------erDGFVFTEINTVVNAFHIEALKQMAEMAMAVGKt---eD-ADAFAARAELAVAAFQKTLFd 600  Pirellula sp.
Q8A8Z8  625 SFGLGDWYdygd-----fraGFSRNTPVPLVATAHYYMTVMYLIKAARMVGNe---fD-VRYYSSLAYDIMVAFNKRFLd 695  Bacteroides thetaio...
Q5ATB5  616 EHGLGDWGr-----------DIAFGNHQANIETAVYYRCLRNVALMAKELGQa---dD-EAKFTAWAERIYAVYNKHLLi 680  Aspergillus nidulans
Q9RK18  841 VTALGDYLap--------gyGGNPPEDTRLTATAYLYRALLHTAELGEALTGlpgdnDvPGRYRAAAEELRKAFNEAFL- 911  Streptomyces coelic...
Q8A4S3  606 SWGRGDWV------------PVKSHSSKELTSSVYFYVDTKILANAAKLFNKq---eD-YKHYQALAEKIRQAINDKYLn 669  Bacteroides thetaio...
Q5LID7  607 NHGLGDWL------------FYKAETPVDFMATGFVYWDNLMMAQMAELTGRv---eD-RQKYLAKAEELKKRINDHFFd 670  Bacteroides fragili...
Q8A904  605 KDKYGDWCvppeslemihsqDPARKTDGALIATAYYLKVLQLMHRFASLQGLt---aD-AKEWEDLEHKMKDAFNAHFLh 680  Bacteroides thetaio...
3W5M_A  802 ASDG--------------KVKGDT-----QSAYVLTLSMNLV----------PDALR-KAAADRLVALIEAKDWHLSTGF 851  Streptomyces avermi...
Q5LHS9  675 TELG--------------YYSNNT-----VTANILSLRFGMV----------PEAYKeVVFRNIVEKTTKDFNGHVSTGL 725  Bacteroides fragili...
Q8A0E5  673 PGKG--------------IYSTGS-----QLDMCYPMLVGAV----------PDSLYdDVKRKMMTDTEKQHKGHIAVGL 723  Bacteroides thetaio...
Q7UYB9  601 EETGiyr--------dgvGTEHSS-----IHANFFPLAFGLV----------PEDKQaGVVDWLATKGMDCSVY------ 651  Pirellula sp.
Q8A8Z8  696 SNTA--------------QYGTGS-----QASNALPIFLQMIqstgdkgdytPDASLaAKVLTNLIKDVESHGNRLTTGD 756  Bacteroides thetaio...
Q5ATB5  681 NDKAsrpyafy-tsldnpGTYDCT-----MVAQAVALQFGLV----------PVEHR-AEVIKAFLSACEASGNRIEAGE 743  Aspergillus nidulans
Q9RK18  912 GPDG--------------HYRTAKdpdyrQTSNAIPLAFGLV----------PPGAR-ATVLESLVADIEERGNHLNTGA 966  Streptomyces coelic...
Q8A4S3  670 RETG--------------IYASGV-----QTELSVPLMWGIV----------PKDMK-AKVARNLAKKVEEAGFHLDVGV 719  Bacteroides thetaio...
Q5LID7  671 SQTV--------------SYANKT-----QLSYALPLYLHIV----------PEAYR-ERLAENLHKIIAANDYSLDFGF 720  Bacteroides fragili...
Q8A904  681 IKEGtslvpghtlypdsvFYGNNT-----VTANILPLAFGLV----------PKAHIkEVAKNAVTTIITTNKGHISTGV 745  Bacteroides thetaio...
3W5M_A  852 LGTPRLLPVLTD--TGHTDVAYRLLHQRTFPSWGYPIDK-GSTTMWERWDSIQpdggfQTPEMNSFNHYA-YGSVGEWMY 927  Streptomyces avermi...
Q5LHS9  726 VGIQQLMRGLSD--YGRTDLAYRIATNRTYPSWGYMVDN-GATTIWELWNGNT-----ADPAMNSANHVMlLGDLIVWAY 797  Bacteroides fragili...
Q8A0E5  724 VGVPILTEWAIR--NREVDFLYQMLKKRDYPGYLYMIDN-GATATWEYWSG-----------ERSRVHNC-YNGIGTWFY 788  Bacteroides thetaio...
Q7UYB9  652 -AAQYFMDALFQ--NGGEHKALALMLADGDRSWKHMVNS-GTTITWEAWEM-------KYKPNQDWNHAW-GAAPANLLP 719  Pirellula sp.
Q8A8Z8  757 VGNRYLIQTLAR--NGQHELIYKMFNHEEAPGYGFQLKF-GATTLTEQWD---------PRQGSSWNHFM-MGQIDEWFF 823  Bacteroides thetaio...
Q5ATB5  744 IGLKYLWNTLAEpdVDRPDIVLAMARQEEHPSYMRFLRR-GETTLLEFWQ----------DACRSKCHDM-LGTIYEWFY 811  Aspergillus nidulans
Q9RK18  967 LGTSVLLRVLCA--HGRPDVAHAVATRRTYPGWGYWHDN-GADTMWEMW----------PLDSRSRDHYF-QGTVAQWLY 1032 Streptomyces coelic...
Q8A4S3  720 LGAKAILNALSE--NGEAETAYKVAAQDTYPSWGCWIAN-GATTLLENWDL-------NATRDISDNHMM-FGEIGGWFY 788  Bacteroides thetaio...
Q5LID7  721 IGSVMVPDVLAE--TGYAETAYRMLTKTTLPSWGYWIKEtGATSLYETWDV-T-----RRIGDASLNHPS-MGAVSAWMY 791  Bacteroides fragili...
Q8A904  746 IGTQWLMRELSR--RGHTDVAYLLATNDTYPSWGYMAAQ-GATTIWELWNGDT-----ANPGMNSGNHVMlLGDLLPWCF 817  Bacteroides thetaio...
3W5M_A  928 ANI 930  Streptomyces avermitilis MA-4680 = NBRC 14893
Q5LHS9  798 GYL 800  Bacteroides fragilis NCTC 9343
Q8A0E5  789 QAI 791  Bacteroides thetaiotaomicron
Q7UYB9  720 RHV 722  Pirellula sp.
Q8A8Z8  824 NSL 826  Bacteroides thetaiotaomicron
Q5ATB5  812 EAV 814  Aspergillus nidulans
Q9RK18 1033 ENV 1035 Streptomyces coelicolor
Q8A4S3  789 KGL 791  Bacteroides thetaiotaomicron
Q5LID7  792 KYP 794  Bacteroides fragilis NCTC 9343
Q8A904  818 NNL 820  Bacteroides thetaiotaomicron
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap