6Q2F


Conserved Protein Domain Family
Glyco_hydro_106

?
pfam17132: Glyco_hydro_106 (this model, PSSM-Id:407266 is obsolete and has been replaced by 435739)
alpha-L-rhamnosidase
Statistics
?
PSSM-Id: 407266
Aligned: 18 rows
Threshold Bit Score: 1131.28
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6Q2F_A           47 KDPPSSARPRVWWHWXNGNITKDGIRKDLEWXKRVGIGGLQNFDANLQTPQIVDHRLVYXTPEWKDAFRFAAHEADRLDL 126 
WP_094466366     32 ANPPQEARPRVWWHWMNGNISKYGIKKDLEWMHRAGIAGIHVFDAGLNTPQIVPHRITYMTPEWKDCFRYAVHIADSLGM 111  Prevotella ...
CDC99162         31 INPPQSARPRVWWHWMNGNISRDGIRKDLEWMNRAGLGGIHIFDAGKKTPQVVPQRIIYMTPEWKECYAYAVALADSLGM 110  Prevotella ...
CDC99159         29 LNPPHEARPQVWWHWLNGNITPDGIRKDLEWMHRVGISGVHLFDAGLNTPQIVPQRVKYMTPEWNDCLRLAVGLADSLGM 108  Prevotella ...
WP_013837086     47 KDPPSSARPRVWWHWMNGNITKDGIRKDLEWMKRVGIGGLQNFDANLQTPQIVDHRLVYMTPEWKDAFRFAAHEADRLDL 126  Novosphingo...
Q2G7K6           45 QDPPMEARPRVWWHWMNGNITKDGIAKDLAWMKRVGIGGLQNFDAGLDTPQVVDKRLVYMTPEWKDAFRFAAIEADRLGL 124  Novosphingo...
jgi:Niako_1916   26 LSPPESTKPWVYWYWDNDNISKEGITKDLEAMAQVGIG--EALIGNIVGGASSKGKVTVLSEDWWSCMVHAITEAKRLGM 103  Niastella k...
jgi:Phep_3973    42 KVTPDTIQTSVYWYWMSDNISKEGVVRDLKAMKTAGIN--RAFIGNIGYNSTPYGKVKLFSKQWWDILHLALKTAGELGI 119  Pedobacter ...
OUJ74560         39 KNPPEAAWPRTWWHWTNSNISKEGITKDLEWMKRSGIAGFQLADVGAGGGQTVNEKIVFGTPAWLDAVKHTAAEADRLGL 118  Hymenobacte...
jgi:Oter_2278    39 RNPPDSAKPRTWWHWTMSNVTKDGITKDLEWMKRVGLGGFQLADVNVGRGQEVEPKTPYGTPAWYDAVRHAAAEADRLGL 118  Opitutus te...
6Q2F_A          127 ELAIAASPGWSETGGPWVKPQDGLKKLVWSETTLAGGQRFVGRLASPPGTTGPFQTL--------HppvtieeiISGVPA 198 
WP_094466366    112 TMAIPSSPGWSNTGGPWVTPHDAMKKITWRAVRVKGGKKLTVNLPGIYTTTGHFQNV---------------------EN 170  Prevotella ...
CDC99162        111 EATMTATPGWSNTGGPWVKPCDAMKKLVWREVTIKGGKTINMTLPEPYSVSGAFQNI-------------------RARG 171  Prevotella ...
CDC99159        109 DIVLPSAPGWSNTGGPWVAPDDAMKRIEWRDTVINGGTLTSMALPAPYTHSGEYQNY------------------RNKGK 170  Prevotella ...
WP_013837086    127 ELAIAASPGWSETGGPWVKPQDGLKKLVWSETTLAGGQRFVGRLASPPGTTGPFQTLhppvtieeI--------ISGVPA 198  Novosphingo...
Q2G7K6          125 ELAIAASPGWSETGGPWVKAEDGLKKVVWSETVLKGGKRFSGKLPLPPAETGPFLDMpes--dplA--------AIVGDH 194  Novosphingo...
jgi:Niako_1916  104 KIGVFNCPGWSQSGGPWVKPEQTMRYLVSTELQVTGGQSFAYAFKPP--------------------------------- 150  Niastella k...
jgi:Phep_3973   120 EIGIFNSPGWSQSGGPWIRPEQSMRYLTSSETLIKGGGRVNVLLEKP--------------------------------- 166  Pedobacter ...
OUJ74560        119 EMTMFTSPGWSLTGAPWVKPEQAMKKLVWSELQVEGGKAFKGKLPQPPSVEGAIRNL-------------------ARSK 179  Hymenobacte...
jgi:Oter_2278   119 EMSIFSSPGWSETGGPWVKPEQAMKKLVWSETVVDGGKRFSGKLASPPNAIGQIRDS--------G--------ASYYTS 182  Opitutus te...
6Q2F_A          199 ETGGVSYAGEVGVLAFPVP---DIASLPVPRALDGAGNVLAGKALVDADIAGGVTLARVD-GKAPLLRLDYQRPVTVRSA 274 
WP_094466366    171 TNSPETFSQQIGIVAVRMPd-tDIEIASLNPTITVSKGEPTVAQLTDGDYSKGTRVEPDAeGN-IWAQYTFEKPVTIKAL 248  Prevotella ...
CDC99162        172 TASSKTYYKDIAVVAVRTd--gELTLGEMGAKATASNGAIDLTMLTDGDMAKTQKLTADStGKVAWIKIELDKAYTIRAL 249  Prevotella ...
CDC99159        171 GVKQTPYYKDLYVIAVPVAd-dAVGMASMVKRITTSEGSINGSHLYDGDFTHTFAIGPRK--KQAWIQVELDSPHTIRSM 247  Prevotella ...
WP_013837086    199 ETGGVSYAGEVGVLAFPVP---DIASLPVPRALDGAGNVLAGKALVDADIAGGVTLARVD-GKAPLLRLDYQRPVTVRSA 274  Novosphingo...
Q2G7K6          195 GFKAPALYSDVAVLAVP-----DLGKPLPVPAYSAGGKSLDAAALSDGSLKTGVTLARGPvDAPTTIVAAYGAPQTVRSA 269  Novosphingo...
jgi:Niako_1916  151 ----TENFQLVSVQAFPVPa-eDNDGVSTKSPVVSSKGMNNAQWLFDGDPNTEVVVPATEqQ----LEIKLNSVATVRSL 221  Niastella k...
jgi:Phep_3973   167 ----KPQFQDVRVVAFRAPeayGSTLTDLRPVLTSKPELPQLQNLIDRDTSTAITITD---ANQVNIDFQTEREYTARSL 239  Pedobacter ...
OUJ74560        180 NSPATGFYGETAVIAYRTPt-aEADESRLQPTVTTNAGAIDAKALLDDDLNTSLVVKPTEkRGTAWVQYSFKQPTKVQAF 258  Hymenobacte...
jgi:Oter_2278   183 DSTSAPFYADAAVVAYRVPa-aEPRMADLHPRVSTHEGEIDGTALLDDKLATLLTVKAPE-GGAAWVQFEFAEPFTARAI 260  Opitutus te...
6Q2F_A          275 TVF---VPNVRIPFAGAAFaGTLESSQDGKTWTPIKAL-------ELSNVP-----TTISFAPVEAAHFRLVLNPGQPDA 339 
WP_094466366    249 SLSdgnNRSTWNSWSAPLY-YRLETSNDGKTFTKVCDI-------PQSGTFq----QTIDLPPTTARCFRVVCQLPQKDK 316  Prevotella ...
CDC99162        250 ALAdgrQHSQWRNKRPAPT-KWLEASNDGLHFTKVCDL-------VLGGAPl----TTVDITPTTAHYFRVVWK------ 311  Prevotella ...
CDC99159        248 TIAdshLLGAWEKYPNNPT-KYLEASDDGREWRRVCNV-------PNGATPr----LTLSLPPTEARYFRLVYQ------ 309  Prevotella ...
WP_013837086    275 TVF---VPNVRIPFAGAAFaGTLESSQDGKTWTPIKAL-------ELSNVP-----TTISFAPVEAAHFRLVLNPGQPDA 339  Novosphingo...
Q2G7K6          270 TVS---IPGAKGTFSGPTVqMHLEASDDGQAWRKVADF-------PVTAAP-----STVGFPAVTARQFRLVLAPLPFNG 334  Novosphingo...
jgi:Niako_1916  222 QITpgnDPVTAD--------CDLEAINDKGAWQRITHLhidrsnmDIAVGPmrygpVVISFPAVKAQTFRLRFT------ 287  Niastella k...
jgi:Phep_3973   240 TIYpaaYQMTAS--------AELQIREAGG-YRTIRSFeidrrrnALNVGFdpyaaIVISFPASTSKHFRLVLKKSMLAG 310  Pedobacter ...
OUJ74560        259 TVAg---------tRGIPF-GRLQASSDGKQFTTLTAL-------PGKQGYrggtvRTFSIPTTTARYYRLELSGAPMKP 321  Hymenobacte...
jgi:Oter_2278   261 TLGgs-----gGSAKGIPV-GRVLASDDGVSFRPLVTL-------PGAQLYrqgmvRTFALPETTARFYRIELTGAPLGP 327  Opitutus te...
6Q2F_A          340 Algspap-gvagndLFGAIaSKRAGQPIXVGQFELHSDALVDRYETKA-------GFV---XSRDY-YALVGPh-DNVTG 406 
WP_094466366    317 Q-----------------------GEYVNLMEYNLYTTSRINFAEEKA-------GFT---SFGDL---DQYPsrLDSDV 360  Prevotella ...
CDC99162        312 ----------------------ADRRPLAISELNLFTSFRVNHAEEKA-------AFG---TPVDL-PLYPTP--ETDKA 356  Prevotella ...
CDC99159        310 ----------------------PNARPATISEFTLSTESRINHSEEKA-------GFGgplRLIDY------PtnAGSHA 354  Prevotella ...
WP_013837086    340 Algspap-gvagndLFGAIaSKRAGQPIMVGQFELHSDALVDRYETKA-------GFV---MSRDY-YALVGPh-DNVTG 406  Novosphingo...
Q2G7K6          335 SnmgdpmpglapvgGFVEMmAAAAKAPFDVKQFRLSSDVMVDQFESKA-------GFA---VVPDY-YALGTPd-AAAAG 402  Novosphingo...
jgi:Niako_1916  288 -----------------------NGKGGKLREIELSGAPRLTAYVEKQlgkmwpyAEV---RPDSYtWPATAEpeHKSLV 341  Niastella k...
jgi:Phep_3973   311 Q----------------------SFPKYGIREFILSSVPRVERYVEKTfakmvqtPLP---YWNEYqWPQQLVvgDKNLL 365  Pedobacter ...
OUJ74560        322 A-------------EVISEaAAQPDSSYALNEFQLHAGARVNRWEDKA-------GFN---FLFEY-ESTATPpvSAPAT 377  Hymenobacte...
jgi:Oter_2278   328 A-------------QTMSQaPSAPAKEYVLSEAVLHSGARVHRWEEKA-------GFS---FLFEY-ETVATPeiAPALA 383  Opitutus te...
6Q2F_A          407 VDPDSVIDLTDKLKADGTLDWAAPKlpagQHWRVLRLGYSLLGTTNHPAPPEATGLEVDKFDGEAVREYLEHYIGXYKDA 486 
WP_094466366    361 SAAGDVVVLTDKVDADGRLTWNAPR----GNWVIYRFGTSLFGSRNGPASPEATGLEVDKMDREAVHKYIEHYIDLYRDA 436  Prevotella ...
CDC99162        357 TALTDVVDLTHLTDSTGRLTWKAPM----GRWRILRFGYSLTGKMNHPASPEATGLEVDKMSAEAVQRYISTYLATYVDA 432  Prevotella ...
CDC99159        355 TGLDSVIDLTRYMDAQGRLSWQAPE----GRWRIYRFGYSLTGKTNHPASPEATGLEVDKLDSTAVRRYMEAYIDTYRRV 430  Prevotella ...
WP_013837086    407 VDPDSVIDLTDKLKADGTLDWAAPKlpagQHWRVLRLGYSLLGTTNHPAPPEATGLEVDKFDGEAVREYLEHYIGMYKDA 486  Novosphingo...
Q2G7K6          403 IDPKQVIDLTGRMKPDGTLDWTAPK----GNWRIIRLGSSLLGTTNHPAPPEATGLEVDKFDGDAVRRYLEHYIGMYKDA 478  Novosphingo...
jgi:Niako_1916  342 VDPARVIDLSTKVDKSGNLNWAVPA----GEWIILYTGMTPTGVTNSPTTTEGSGLEIDKMNKQLAQFHFDAFIGELLKR 417  Niastella k...
jgi:Phep_3973   366 IEPKNVLDVSRFMSPDGNFNWDAPA----GDWVIMRMGMTPTGVNNSPASREGTGLEVDKMSKEHLRSHFDSFLGEILRR 441  Pedobacter ...
OUJ74560        378 ISPTNVVVLTSKMQPDGTLTWQVPP----GKWTILRMGYSLTGARNRPAVPAANGLEVDKLSRKHTEAYMHGYTEPLRQA 453  Hymenobacte...
jgi:Oter_2278   384 VAPDDLVDLTAKLQPDGSLEWDAPP----GRWTILRLGYSLTGAKNRPATPAGTGYEADKLSRRHMEAYVRGYFDPLQQA 459  Opitutus te...
6Q2F_A          487 AGPDxVGKRG-VRALLTDSIEVGEANWTPRXLEQFQRLRGYDARPWLPALTGTLVGTREQSDRFLYDYRRTLADLLASEH 565 
WP_094466366    437 SGGN-IGKRG-IQYLLIDSYEPGKATWTLQMPAQFERRRGYSIYPWLPVLTGVIVGSVEQSEQFLYDYRQTIGELMDESL 514  Prevotella ...
CDC99162        433 SRGM-MGKRG-LQNLLIDSYEAGIANWTPRMAEEFKARRGYELLPWMPALAGTIVESSEKTDRFLFDWRRTIGELIEQNL 510  Prevotella ...
CDC99159        431 VGDS-MIGRV-INGLLIDSYEAGYATWTRHMREEFRSRRGYDLLPYLPALAGEVIGSAEASDRFLDDWRLTLGELIADNL 508  Prevotella ...
WP_013837086    487 AGPDmVGKRG-VRALLTDSIEVGEANWTPRMLEQFQRLRGYDARPWLPALTGTLVGTREQSDRFLYDYRRTLADLLASEH 565  Novosphingo...
Q2G7K6          479 AGSElVGKRG-VRAILTDSIEVGAANWTPRMVEQFKRLRGYDPTPWLPTLAGVLVGTRAQSDGFLRDYRQTLADLMASEH 557  Novosphingo...
jgi:Niako_1916  418 TPAE---DRVaLRHVVADSYEKGSENWTDGLGEDFKRTYGYDPYPFLPVLTGRIVASADRSDRFLWDLRRLVADRIASNY 494  Niastella k...
jgi:Phep_3973   442 IPAA---DRKtWKVVVQDSYETGGQNWTDGLIEKFKARYGYDPLPYLPALQGKVVGNPDMSDRFLWDLRRFIADKVAYDY 518  Pedobacter ...
OUJ74560        454 LGPL-YGKS--LRYMLMDSWEAGIQNWTDEMLPEFQKRRGYDLTPYLPVLAGRVVGSAEISDRVLWDFRRTLVDMFAENH 530  Hymenobacte...
jgi:Oter_2278   460 LGPL-FGKS--LRYVTMDGWEAGTNNWTDELPAEFRRRRGYAPTPYLPALTGRIVGSADVSDRFLWDFRRTLADLWAEAH 536  Opitutus te...
6Q2F_A          566 YGTVADVAHENDLKVYGEALEDHRPXLGDDXAXRSHADIPXAALWTFNRDEGPRQTL----IADXKGAASVAHLYGQNLV 641 
WP_094466366    515 YAEVADAAHRHGMKIYIESHENGRQMLADGISVKSKGDIPMGAMWAEKRADLSMYEC------DLRETSSTAHIYGKKYV 588  Prevotella ...
CDC99162        511 YRQVADTMKARDMGTYFESHESCRVYEADGMAVKQYCTIPMGAMWASEPVMHMNDRGetgkQGDIRESASVAHIYGQNLV 590  Prevotella ...
CDC99159        509 YGQVGRIAHEQGLTTYFEAMENSRPFVGDGLAPKCKADIPMAAMWARTQTLDFTQKMflemQADLMESASAAHVFGRKHV 588  Prevotella ...
WP_013837086    566 YGTVADVAHENDLKVYGEALEDHRPMLGDDMAMRSHADIPMAALWTFNRDEGPRQTL----IADMKGAASVAHLYGQNLV 641  Novosphingo...
Q2G7K6          558 YGTVARVAHENDLKVYGEALEDNRPSLGDDIAMRSHADVPMSALWTFSRKAGPNPSy----IADMKGAASTAHIYGQNLV 633  Novosphingo...
jgi:Niako_1916  495 VGGLRERCQQNGLRLWLENYGHW-GFPGEFLSYGGASDDLGGEFWYGVPSLGPV---------EVRCASSAGHTYGKKVV 564  Niastella k...
jgi:Phep_3973   519 VGGLREISHQNGLRTWLENYGHW-GFPGEFLQYGGQSDEVAGEFWAAGELGNI----------ENRAASSAAHIYGKTKV 587  Pedobacter ...
OUJ74560        531 YGTVTDYLHKQGIQTYGEAGGVSLETIEDALLYKKYVDIPMGEFWVKDLHPSSMYYE------DVRGAASSGHVYGKNLI 604  Hymenobacte...
jgi:Oter_2278   537 YGTMAEKLRERGVGIYAEAAGVSLEMPEDTLLNKSKVEIPMGEFWVRDLHPRLMYLQ------DIRGAASAAHVYGKPLV 610  Opitutus te...
6Q2F_A          642 AAESXTASX------APWAFAPKDLKRFIDLEFVTGVNRPVIHTSVHVPVDDKKPGLSLAIFGQYFNRQESWAEXARPWV 715 
WP_094466366    589 AGESFTADGrh---eMCYTFYPGNLKPIADYMMSCGLNRFIIHESAHQPVDDRKPGLALAIYGQWFNRHETWAEQARPWT 665  Prevotella ...
CDC99162        591 AAESLTSNGmdg-ngLAYSLTPNLLKPVADLEFASGVNRIVIHDSAHQPIDTKIPGQGLEVYGQWFHRHETWAEQARPWV 669  Prevotella ...
CDC99159        589 AAESFTAYGpsqgdsLVYGLYPAMLKRIADLEFACGVNRIVIHESAHQPIDSMVPGLSLDIYGMWFNRLSTWAEQARGWT 668  Prevotella ...
WP_013837086    642 AAESMTASM------APWAFAPKDLKRFIDLEFVTGVNRPVIHTSVHVPVDDKKPGLSLAIFGQYFNRQESWAEMARPWV 715  Novosphingo...
Q2G7K6          634 AAESMTSAL------APWAYAPNELRRIIDLEFASGVNRPVVHTSVHQPVDDKVPGMSLMIFGQYFNRHEAWAELARPWV 707  Novosphingo...
jgi:Niako_1916  565 SAEAFTS-G------LSFTQMPRNLKTRGDWAWSEGINHFVMHVYIHQP-DDRKPGMS-AWFGTDFNRNNTWFTQSKTYF 635  Niastella k...
jgi:Phep_3973   588 SAESFTAGG------KPYIRYPAYIKQRGDRFFTEGINNTLLHVFIQQP-DERMPGVN-ANFSTEFNRHNTWFNYLDLFT 659  Pedobacter ...
OUJ74560        605 AAESFTGGN---------FESPYTLKKISDYWFTQGINRLVFHTSAHQPLDTK-PGNTM--VGTHLNRNITWAEQAKPLM 672  Hymenobacte...
jgi:Oter_2278   611 AAEAFTGGG---------YEAPATLKNVGDTWLAQGVNRIVFHTSAHQPLDTK-PGNMM--VGTHLHRNITWAEQARPIM 678  Opitutus te...
6Q2F_A          716 DYIARSSLLLQTGRNVADVAYFYGEEAPLT-GLY-GDePVADAPVRYAYDYINFNALTELLAN-DGEDLVAPSGARYKTI 792 
WP_094466366    666 DYLGRSSYMMQQGKYVADIAYYYGGDNSVT-GRF-AH-NHPAIPRGYNFDYVNPGALMDVFGY-DGQKLTTKAGMSYRLL 741  Prevotella ...
CDC99162        670 DYLSRTSYMLQQGRYVADVAYYYGDDNNVT-GLF-YA-NQPQVPPTASYDYVNTPALTEQLTC-SDGKITTPSGMTYQVL 745  Prevotella ...
CDC99159        669 DYMARSSYMLQQGNNVADVAYFYGDEANAT-ALF-DK-QKPAIPSSCNMDFINSDILCHHLDA-DGGQLVTPGGSRYRML 744  Prevotella ...
WP_013837086    716 DYIARSSLLLQTGRNVADVAYFYGEEAPLT-GLYgDE-PVADAPVRYAYDYINFNALTELLAN-DGEDLVAPSGARYKTI 792  Novosphingo...
Q2G7K6          708 DYMARSSLLLQAGRNVADVAYFYGEEGPLT-ALYgRK-RIEDAPKVHAYDFINRDALFDAVEV-QGGEVVAKGGARYKAI 784  Novosphingo...
jgi:Niako_1916  636 DYIRRSCALLQQGHTVADVAYFIGEDAP---KMT-GD-KDPALPPGYNYDFINAEMLAKARVV--NDRIVLASGASYAVL 708  Niastella k...
jgi:Phep_3973   660 AYLKRCNFMLQQGKYVADVAYFIGEDAP---KMT-GI-TEPALPSGYSFDYINAEVIINRLSV-KNGRLFLPDGMNYGLL 733  Pedobacter ...
OUJ74560        673 TYLARNTFMLQQGQYVADVAYLLNEGAPSTmPFWgAG-LQPALPEGYAFDYINADALITRMTVnDKGRLVLPDGMSYGVL 751  Hymenobacte...
jgi:Oter_2278   679 TYFARSCFLLQQGRFVADLAYLLDEGAPSTpPIWgAG-TRPTPPAGYDYDFVNADVLLHRFSSgGNGKLMLPDGMSYRVL 757  Opitutus te...
6Q2F_A          793 YLGGSSSHXTLAALRKLAALVVGGATVVGKAPIATP----SntsaQEG---DLTEWSSLVARLWpgSGda-------rvG 858 
WP_094466366    742 VIDRQVTRMTVDELKAIARLAKAGAPICGKRPTIQP----N----LKG---NDAEWHRLVAEIW--DG-----------N 797  Prevotella ...
CDC99162        746 ALDANTQRMTVPALRHIAAMVGKGMKLCGARPQAVL----S----LND---DKAEFDRLVAEIW--DA-----------N 801  Prevotella ...
CDC99159        745 VLGGTSDRLSLASLQAVKRLADQGATIVGRRPARAM----G----LKA---DSAEFDRIADDLW--SG-----------K 800  Prevotella ...
WP_013837086    793 YLGGSSSHMTLAALRKLAALVVGGATVVGKAPIATPsntsA----QEG---DLTEWSSLVARLW--PGsgd-----arvG 858  Novosphingo...
Q2G7K6          785 QLGGSSRRMTLPTLRRLAALVEAGATVVGSPPEGSP----A----LND---SAADFSALVAKLW--SGqlv-----trvG 846  Novosphingo...
jgi:Niako_1916  709 VL-PPKETMRPEILKKIVALVADGACVLGNAPAHSP----S----GRDypfCDTRVQALAKELW--Gfk--------mvG 769  Niastella k...
jgi:Phep_3973   734 VL-PALETIRPELLEKIRNLVSQGAAVMGPAPKRSP----S----LEHyplADQHVSAMAKELW--GNingttitsrkyG 802  Pedobacter ...
OUJ74560        752 VL-PEIEQMTLPVLRKVRELVQGGATVVGPKPVKAP----G----LTAypsSDPELQEIASDVW--GDldgrsrtkrryG 820  Hymenobacte...
jgi:Oter_2278   758 VL-PDTDRMRPELVRKLRELVLGGATIVGRKPTRSP----S----LADyprADAEVHALAAELW--GDldgvsrtvrrvG 826  Opitutus te...
6Q2F_A          859 KGRVIASQDIESALQAXDVAPDF----TFT--GaDAgvKIPFVHRRDGKGEIYYLVNQQEAAQSIEAHFRVTGKQPELWH 932 
WP_094466366    798 RANVMENLSMEEALAKTGVAPDFsfvaADKdkAtPD--SIRWMHRRTADSEIYWVANAIDQPKRITASFNVTGKKPMLWN 875  Prevotella ...
CDC99162        802 RPNVKENASIADALAAWGIAPDFy---CDR----MD--SLRFVHRQTPQAEIYWVNNRSYQTRSLDARFRVTGMKPYLWH 872  Prevotella ...
CDC99159        801 RSNIVDTGSTRHAIDSLLDVPDFr---CTH----MD--SIRYVHRTTGDAEIYWVNNRSKSDMHDWFEFRTTGRKPQIWN 871  Prevotella ...
WP_013837086    859 KGRVIASQDIESALQAMDVAPDF----TFTgaDaGV--KIPFVHRRDGKGEIYYLVNQQEAAQSIEAHFRVTGKQPELWH 932  Novosphingo...
Q2G7K6          847 AGQVIASADIDRALADAGIAPDL----VLDgtSeDG--EVLFVHRALPDGDAWFLNNRKAAPEVVEARFRVTGKQPELWH 920  Novosphingo...
jgi:Niako_1916  770 KGHVFTGIGLKKVLRQIGVAED-----CVL----GK--DFLYTHRQEGNAHCYFVSNQLDIARKDTMAFRVTGLQPELWD 838  Niastella k...
jgi:Phep_3973   803 KGQVLYGTDLSTALNRLNIVPDYk---TNH----TD--SILFIHRTTPEAEIYYVSNQKNKPVSVLSEFRVGNKQPELWD 873  Pedobacter ...
OUJ74560        821 KGQIVWGLPLAQVMPLAGLTPDVe---CSR--PlGS--QVPWIHRRVGDADVYYVVNRSDSTQDLKAQFRVSGKDVALWH 893  Hymenobacte...
jgi:Oter_2278   827 KGTVVWGLPRERVLSDEGIAKDFd---ADQ--PlDA--EFAWLHRRAGEIDLYYVANLTDRTQAIDARFRVSGREAELWH 899  Opitutus te...
6Q2F_A          933 PETGKSEPI-SYRI 945 
WP_094466366    876 AENASIKPV-GYTM 888  Prevotella sp. P5-108
CDC99162        873 PETGEVSAV-DYTP 885  Prevotella sp. CAG:474
CDC99159        872 AVTGEISDV-TYMT 884  Prevotella sp. CAG:474
WP_013837086    933 PETGKSEPI-SYRI 945  Novosphingobium sp. PP1Y
Q2G7K6          921 ADTGETEAI-SYRI 933  Novosphingobium aromaticivorans DSM 12444
jgi:Niako_1916  839 AVTGQIKALpNYAI 852  Niastella koreensis GR20-10
jgi:Phep_3973   874 PVDGTTRALpQYEH 887  Pedobacter heparinus DSM 2366
OUJ74560        894 SATGQMEPA-GYTI 906  Hymenobacter sp. MIMBbqt21
jgi:Oter_2278   900 PDTGKIERV-GFTQ 912  Opitutus terrae PB90-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap