1GQL


Conserved Protein Domain Family
Glyco_hydro_67M

?
pfam07488: Glyco_hydro_67M (this model, PSSM-Id:400047 is obsolete and has been replaced by 462180)
Click on image for an interactive view with Cn3D
Glycosyl hydrolase family 67 middle domain
Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
Statistics
?
PSSM-Id: 400047
Aligned: 99 rows
Threshold Bit Score: 473.513
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GQL_A          130 LIQTQHALEKLSLSSAPRLQHRVVNHWDNlnrvvERGYAGLSL-WDWGSLPNYLApRYTDYARINASLGINGTVINNVNA 208 Cellvibrio j...
jgi:GYMC10_6095 138 LLASHQPLTGLNITEQPVNGVRMINQWDNadgsvERGYSGNSIfYENGRFTENLD-RVRDYARLLASVGLNAISINNVNV 216 Paenibacillu...
WP_015360033    128 LLQLETPLEKINLVNNPANMLRMINHWDNmdgtiERGYAGNSIfYANNGFIDDKT-RVRDYARLLASIGINGIVINNVNV 206 Thermoclostr...
WP_012634595    143 LLQTEATISGILKIENPANQLRIINHWDNidgsiERGYAGKSIfFTDNKVTEDLG-RIKDYARLLCSVGINSIVINNVNV 221 Ruminiclostr...
jgi:Clocl_0930  142 LLRMQKDIRDIRKIENPYFQMRMLNHWDNmdgsiERGYAGNSIfYKDNKFTDDTA-RVRDYARLLGSIGINGIVINNVNV 220 Hungateiclos...
jgi:Theco_2777  150 gslnDRALEQLDIADRPRNPLRMINHWDNmdgsiERGYAGKSIfFRDGKFIADKT-RVRDYARLLVSIGINALTINNVNV 228 Thermobacill...
WP_012584061    132 RLKRGEDIENIDIVSNPSLRFRMLNHWDNldgsiERGYAGKSIfFRENKILIN-E-RTKDYARLLSSIGVNGVVINNVNV 209 Dictyoglomus...
P96105          121 RIRLGEDIEKMNVLAKPKAKFRMLNHWDNldgtiERGYAGNSIfFKDNRIIIN-Q-RTKDYARLLASIGINGVVINNVNV 198 Thermotoga m...
jgi:Theth_0154  128 RVRVGEDLRKLNVVSNPKIKLRFLNHWDNldgtiERGYAGKSIfFSNNKILLN-Q-RTKDYTRLIASIGINSVVINNVNV 205 Pseudothermo...
jgi:Spica_0602  132 MIQKRIDYKKINIHESPSNPLRLLNHWDNldgsvERGYAGASLfFKNNQIMIDHE-RHHDYARLLASIGINGTVINNVNV 210 Treponema ca...
1GQL_A          209 DPR---VLSDQFLQKIAALADAFRPYGIKMYLSINFNSPRAFGDVDTADPLDPRVQQWWKTRAQKIYSYIPDFGGFLVKA 285 Cellvibrio j...
jgi:GYMC10_6095 217 HEIetkFITAEYLPTIAKIADIFREYGITLYLSINFAAPLHIGGVPTSDPLNEEVRQWWKDTADEIYDHIPDFGGFVVKA 296 Paenibacillu...
WP_015360033    207 HYHetrLITKLYLPEVAKLADIFREYGITVFLSVNFASPVELGELPTADPLDVRVQNWWREKAEEIYSYIPDFGGFLVKA 286 Thermoclostr...
WP_012634595    222 HKYesmLITDKYLNDVASLAQIFRDYGIKLYLSANFASTIEIGGLATADPLDPQVRKWWKEKADEIYSLIPDFGGFLIKA 301 Ruminiclostr...
jgi:Clocl_0930  221 HKYetrLITKEYLPDAKKLAEIFREYGIRIYFSINFASPIEIGGLDTADPLDEKVKKWWCDKAGEIYSYIPDFGGFLVKA 300 Hungateiclos...
jgi:Theco_2777  229 HETetkLITDELLPDVAATADIFREYGIRLMLSINFAAPIQAGGLPTADPLDPAVRAWWRERAAAIFRRIPDFGGFLVKA 308 Thermobacill...
WP_012584061    210 KKKeveLITPSYLKKIGELSKIFSAYGIKIYLSINFASPIYLGGLNTADPLDKRVAVWWKAKVDEIYEYVPDFGGFLVKA 289 Dictyoglomus...
P96105          199 KKRevyLIDSIYLKKLKKLADIFREYGIKIYLSINFASPVYLGGLDTADPLDERVARWWREKARGIYDYIPDFGGFLVKA 278 Thermotoga m...
jgi:Theth_0154  206 RHAalkLIEPAYLKRLSQLAQLFQRYGIKLFLSVSFASPIHLGGLDTADPLDERVKKWWKEKVKQIYDYIPNFGGFLIKA 285 Pseudothermo...
jgi:Spica_0602  211 KEKapyLITNEYLNELAELASILRAYNIRLFLSVNFMSPVIVGGLDTADPLDTKVQSWWQERVSCIYDMIPDFGGFLVKA 290 Treponema ca...
1GQL_A          286 DSEGQPGPQGYGRDHAEGANMLAAALKPFGGVVFWRAFVYH------PDIEDRFRGAYDEFMPLDGKFADNVILQIKNGP 359 Cellvibrio j...
jgi:GYMC10_6095 297 DSEHRPGPFAYGRDHADGANMLAEALEPHGGLVIWRCFVYNcmqdwrDRSTDRARAAYDHFTPLDGRFKDNVLLQIKNGP 376 Paenibacillu...
WP_015360033    287 DSEYRPGPFTYGRDHAEGANMLAKALEPFGGVVIWRCFVYNckqdwrDRKTDRANAAYDTFMPLDGKFMDNVILQIKNGP 366 Thermoclostr...
WP_012634595    302 DSEFRPGPFTYGRTHADGANMLAEALEPYGGLVIWRCFVYNcmqdwrDRITDRARAAYDNFMPLDGLFRENVLLQIKNGP 381 Ruminiclostr...
jgi:Clocl_0930  301 DSEFRPGPFTYNRNHADGANMLAAALKPFGGVVIWRCFVYNcmqdwrDYKTDRAKAAYDNFKPLDGMFDDNVILQIKNGP 380 Hungateiclos...
jgi:Theco_2777  309 DSEFRPGPFTYGRDHADGANMLAEALEPFGGIVIWRCFVYNclqdwrDRTTDRAKAAYDHFVPLDGRFKDNVLLQIKNGP 388 Thermobacill...
WP_012584061    290 DSEFNPGPHMYGRTHADGANMLGEALESYGGFVIWRAFVYNclqdwrDTNTDRAKAAYENFKPLDGKFSENVIVQIKYGP 369 Dictyoglomus...
P96105          279 DSEFNPGPHMFGRTHAEGANMLARALAPFGGVVIWRAFVYNclqdwrDYKTDRAKAAYDNFKPLDGQFDDNVIIQIKYGP 358 Thermotoga m...
jgi:Theth_0154  286 DSEFNPGPHMYGRTQADGANMLAEALEPFGGLVIWRAFVYNcqqdwrDYKIDRAKAAYDIFKPLDGQFADNVAIQIKYGP 365 Pseudothermo...
jgi:Spica_0602  291 DSEYNPGPHTYGRSQADGANMLGRALKPYKGVLIWRAFVYKlqd-wrEPSIDRARAAYDIFFPLDGQFEDNVILQIKNGP 369 Treponema ca...
1GQL_A          360 IDFQPREPFSALFAGMSRTNMMMEFQITQEYFGFATHLAYQGPLFEESLKTETHARGEGSTIGNILEGKVFKTRHTGMAG 439 Cellvibrio j...
jgi:GYMC10_6095 377 MDFQVREPVSPLFGSMKETNQVLEFQIAQEYTGQQRHVCYLVPQWKEVLDFDTYANGTGSEVKKIVDGSLHGMKYSGIAA 456 Paenibacillu...
WP_015360033    367 MDFQVREPVSPLFGGLTKTNQMLELQITQEYTGQQKHICYLVPQWKEILDFDTFAEGRGSTVREIIAGKIYPQKYGGIAA 446 Thermoclostr...
WP_012634595    382 MDFQVREPVSPLFGGLQKTNQLLELQITQEYTGQQKHLCYLVPMWKEILDFDTMAKGRNTSVKKIITGSVFNNKLGGMAA 461 Ruminiclostr...
jgi:Clocl_0930  381 MDFQVREPVSPLFGGLKKTNVNLEVQITQEYTGQQKHLCYLIPMWKEVLDFDTYARGKGTTVKKIVRGSVFNNKYGGVAG 460 Hungateiclos...
jgi:Theco_2777  389 MDFQVREPVSPLFGGLTRTNQMLELQITQEYTGQQRHLCYLVPQWKEVLDFDTYACGEGTTVARIASGSAFGRETGGIAG 468 Thermobacill...
WP_012584061    370 MDFQVREPVNPLFGGLEHTNQILELQITQEYTGQQIHLCYLGTLWKEVLDFDTYAKGEGSKVKEILKGNVFDLKNNGMAG 449 Dictyoglomus...
P96105          359 MDFQVREPVNPLFGGMEKTNQILELQITQEYTGQQIHLCFLGTLWKEILEFDTFAKGEGSYVKRIVDGTLFDRENNGFAG 438 Thermotoga m...
jgi:Theth_0154  366 MDFQIREPVSPLFGGMEKTNQILELQITQEYTGQQIHLCYLGTMWKEILDFDTFSKGNNSFVKRIIDGTLYGRKNNGIAG 445 Pseudothermo...
jgi:Spica_0602  370 MDFQVREPVSPLFGKMEWTNQILELQVTQEYTGHQIDLCYLGPQWKEIVGFDTHAKGTQAYVSSIINGSFYNRPIGGIAA 449 Treponema ca...
1GQL_A          440 VINPGTDRN 448 Cellvibrio japonicus
jgi:GYMC10_6095 457 VSNIGNDEN 465 Paenibacillus sp. Y412MC10
WP_015360033    447 VSNIGSDLN 455 Thermoclostridium stercorarium
WP_012634595    462 VTNIGNDLN 470 Ruminiclostridium cellulolyticum
jgi:Clocl_0930  461 VANVGDDDN 469 Hungateiclostridium clariflavum DSM 19732
jgi:Theco_2777  469 VSNIGDDPN 477 Thermobacillus composti KWC4
WP_012584061    450 VSNVGDDIN 458 Dictyoglomus turgidum
P96105          439 VSNVGDSVN 447 Thermotoga maritima MSB8
jgi:Theth_0154  446 VANIGDDPN 454 Pseudothermotoga thermarum DSM 5069
jgi:Spica_0602  450 VSNLGDDYN 458 Treponema caldarium DSM 7334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap