3K11,2GH4,4WU0,5NOA


Conserved Protein Domain Family
Glyco_hydro_88

?
pfam07470: Glyco_hydro_88 (this model, PSSM-Id:400034 is obsolete and has been replaced by 429478)
Click on image for an interactive view with Cn3D
Glycosyl Hydrolase Family 88
Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
Statistics
?
PSSM-Id: 400034
Aligned: 17 rows
Threshold Bit Score: -1
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K11_A  42 YIDKETPARVVDKNTGKVITdytaXGDEAQLErgafrlasYEWGVTYSALI-AAAETTGDKR----YTDYVQNrfrflae 116  Bacteroides thetaiot...
Q8EPL5  15 WAEKACKSMMNQFT---PSQ----LPPQNRWH--------YHQGVFLSGML-EVFKETQGNE----YYNYVKA------- 67   Oceanobacillus iheye...
O31521  14 VIDRIVKRT---------------FQMDFAWD--------WPGGVAFYGVA-EAYEATENEE----YINLLKT------- 58   Bacillus subtilis su...
Q9KDU1  14 KIDRIVNRT---------------FEMDHVWD--------WPAGVAFYGVG-LAYEATKKDA----YLQRLKE------- 58   Bacillus halodurans
Q7CV97  66 VSDGSDGKI--QFD---------------EWD--------WEVGVGLYGFL-RRALAANDQK----ALDDLVT------- 108  Agrobacterium fabrum...
Q8ZNU8  37 nIKDETGEFLLRLDDGRVID----TKGWAGWE--------WTHGVGLYGMY-HYYQQTGDQT----MRKIIDD------- 92   Salmonella enterica ...
Q9KB74  17 NIKRFNGRFPHVSEDGEHYE----LNNNNE----------WTNG-FWSGILwLCYEYTNDPA----FRQAAAS------- 70   Bacillus halodurans
Q8A3J1  31 SMRRVADWQIGHYNRAVYGDl------------------nWVNATFFLGLA-YWAEIAEKDDqddfYYKWLTR------- 84   Bacteroides thetaiot...
Q8A3N3  30 LIDKVAMWQIDHQTKVKHHDl------------------aWTNGVLFRGMV-EWADYTQDSR----YYDFLMQ------- 79   Bacteroides thetaiot...
5NOA_A  36 IIHKVNGYWQTNHPEHGRSF--------------------WDNAAYHTGNM-EAYFLTNKPE----YLEYSKG------- 83   Bacteroides thetaiot...
Q8EPL5  15 WAEKACKSMMNQFT---PSQ----LPPQNRWH--------YHQGVFLSGML-EVFKETQGNE----YYNYVKA------- 67   Oceanobacillus iheye...
O31521  14 VIDRIVKRT---------------FQMDFAWD--------WPGGVAFYGVA-EAYEATENEE----YINLLKT------- 58   Bacillus subtilis su...
Q9KDU1  14 KIDRIVNRT---------------FEMDHVWD--------WPAGVAFYGVG-LAYEATKKDA----YLQRLKE------- 58   Bacillus halodurans
Q7CV97  66 VSDGSDGKI--QFD---------------EWD--------WEVGVGLYGFL-RRALAANDQK----ALDDLVT------- 108  Agrobacterium fabrum...
Q8ZNU8  37 nIKDETGEFLLRLDDGRVID----TKGWAGWE--------WTHGVGLYGMY-HYYQQTGDQT----MRKIIDD------- 92   Salmonella enterica ...
Q9KB74  17 NIKRFNGRFPHVSEDGEHYE----LNNNNE----------WTNG-FWSGILwLCYEYTNDPA----FRQAAAS------- 70   Bacillus halodurans
Q8A3J1  31 SMRRVADWQIGHYNRAVYGDl------------------nWVNATFFLGLA-YWAEIAEKDDqddfYYKWLTR------- 84   Bacteroides thetaiot...
Q8A3N3  30 LIDKVAMWQIDHQTKVKHHDl------------------aWTNGVLFRGMV-EWADYTQDSR----YYDFLMQ------- 79   Bacteroides thetaiot...
5NOA_A  36 IIHKVNGYWQTNHPEHGRSF--------------------WDNAAYHTGNM-EAYFLTNKPE----YLEYSKG------- 83   Bacteroides thetaiot...
3K11_A 117 vapHFKRVYEEKGKtdsql-------lqilTPHALDDAGAVCTAXI----KLRLKDeSLPVDGLIQNYFDfIINKEYRLA 185  Bacteroides thetaiot...
Q8EPL5  68 ---YVDNLIDEEGNfl-------------fARSELDAIQPGLLLLY----LYKHTG-DKRYKIASEKLRN-VLRTINKTR 125  Oceanobacillus iheye...
O31521  59 ---WVDEQLEDGLP-----------------PLSINGVSIGHTLLF----LHKVTG-DDVYLETAAEMAEyVLHKAPRFG 113  Bacillus subtilis su...
Q9KDU1  59 ---WFDEYMDYGIP-----------------PMCVNIVSMGHTLLT----LYQHTG-EEKYLQLAIEKADyLLHDAPRFA 113  Bacillus halodurans
Q7CV97 109 ---WYGWQIDRGLP-----------------PRQINSSAPMLPLVI----LTEHVD-RPDFRALVEDWADwLVHELPKTE 163  Agrobacterium fabrum...
Q8ZNU8  93 ---WFADRFAEGAT-----------------TKNVNTMAPFLTLAY----RYEETR-NPAYLPWLETWAEwAMNEMPRTD 147  Salmonella enterica ...
Q9KB74  71 ---TVRSFQQRMEQ-----------------NLELDHHDIGFLYSLsskaQWIIER-DERAKQLTIEAAD-VL--MKR-- 124  Bacillus halodurans
Q8A3J1  85 ---LGSRNYWQVDK----------------RMYHADDICIAQTYLY----LYEKYK-QKDMIVPTLARTEwVVANPPSGS 140  Bacteroides thetaiot...
Q8A3N3  80 ---IGKKHRWGFLK----------------RLYHADDLVIAQMYIR----MYEKYH-DPVMIQPTIARVDsIVAKPSKAR 135  Bacteroides thetaiot...
5NOA_A  84 ---WAEHNEWKGAKsdhkanwkysygesndYVLFGDYQICFQTYAD----LYNLEP-DTHKIARAREVMEyQMSTPNN-- 153  Bacteroides thetaiot...
Q8EPL5  68 ---YVDNLIDEEGNfl-------------fARSELDAIQPGLLLLY----LYKHTG-DKRYKIASEKLRN-VLRTINKTR 125  Oceanobacillus iheye...
O31521  59 ---WVDEQLEDGLP-----------------PLSINGVSIGHTLLF----LHKVTG-DDVYLETAAEMAEyVLHKAPRFG 113  Bacillus subtilis su...
Q9KDU1  59 ---WFDEYMDYGIP-----------------PMCVNIVSMGHTLLT----LYQHTG-EEKYLQLAIEKADyLLHDAPRFA 113  Bacillus halodurans
Q7CV97 109 ---WYGWQIDRGLP-----------------PRQINSSAPMLPLVI----LTEHVD-RPDFRALVEDWADwLVHELPKTE 163  Agrobacterium fabrum...
Q8ZNU8  93 ---WFADRFAEGAT-----------------TKNVNTMAPFLTLAY----RYEETR-NPAYLPWLETWAEwAMNEMPRTD 147  Salmonella enterica ...
Q9KB74  71 ---TVRSFQQRMEQ-----------------NLELDHHDIGFLYSLsskaQWIIER-DERAKQLTIEAAD-VL--MKR-- 124  Bacillus halodurans
Q8A3J1  85 ---LGSRNYWQVDK----------------RMYHADDICIAQTYLY----LYEKYK-QKDMIVPTLARTEwVVANPPSGS 140  Bacteroides thetaiot...
Q8A3N3  80 ---IGKKHRWGFLK----------------RLYHADDLVIAQMYIR----MYEKYH-DPVMIQPTIARVDsIVAKPSKAR 135  Bacteroides thetaiot...
5NOA_A  84 ---WAEHNEWKGAKsdhkanwkysygesndYVLFGDYQICFQTYAD----LYNLEP-DTHKIARAREVMEyQMSTPNN-- 153  Bacteroides thetaiot...
3K11_A 186 DGTFAR-----NRPQRNTLW-------------LDDXFXGIPAVAQXSRYDKEAknKYLAEAVKQFLQFADR-------- 239  Bacteroides thetaiot...
Q8EPL5 126 EGGYWH-----KDKYPYQMW-------------LDGLYMAGPFAIQFGQLFNEP--KLIDLVLYQEQLMRSH-------- 177  Oceanobacillus iheye...
O31521 114 EGILQHtvnaaEYVFPEQAW-------------ADTLMMAGLFMLRIGRVMERE--DYFEDGLRQFHGHEDV-------- 170  Bacillus subtilis su...
Q9KDU1 114 EGVFQHtvgggVSVFPEQAW-------------VDTLFMAGYFLIRMGDALNNQ--AYMDEGIRQFRGHEKY-------- 170  Bacillus halodurans
Q7CV97 164 DGGFQHvv--kERLNEGELW-------------DDTLFMACLFLARAGVVCKRQ--DWIDEAVYQFMIHARY-------- 218  Agrobacterium fabrum...
Q8ZNU8 148 HGGMQHit--lAEENHQQMW-------------DDTLMMTVLPLAKIGKLLNRP--EYVEEATYQFLLHVQN-------- 202  Salmonella enterica ...
Q9KB74 125 ----WR-----EKIELFQAWgpegdlsnggriiVDCL-MNLPLLFWASEVTGNP--DYREAAIIHADKTRRFivrgddst 192  Bacillus halodurans
Q8A3J1 141 ----FQltygdATTLEHWTW-------------CDALFMAPPVYLKLYNITGDK--KFIRFMDKEYKATYEF-------- 193  Bacteroides thetaiot...
Q8A3N3 136 lwl------gaKNWSERWSW-------------CDALFMAPPVYGQLNKLYPEK--NYLDFMDREFREATDS-------- 186  Bacteroides thetaiot...
5NOA_A 154 ---------------DYWWW-------------ADGLYMVMPVMTKLYNITKNP--LYLEKLHEYLAYADSI-------- 195  Bacteroides thetaiot...
Q8EPL5 126 EGGYWH-----KDKYPYQMW-------------LDGLYMAGPFAIQFGQLFNEP--KLIDLVLYQEQLMRSH-------- 177  Oceanobacillus iheye...
O31521 114 EGILQHtvnaaEYVFPEQAW-------------ADTLMMAGLFMLRIGRVMERE--DYFEDGLRQFHGHEDV-------- 170  Bacillus subtilis su...
Q9KDU1 114 EGVFQHtvgggVSVFPEQAW-------------VDTLFMAGYFLIRMGDALNNQ--AYMDEGIRQFRGHEKY-------- 170  Bacillus halodurans
Q7CV97 164 DGGFQHvv--kERLNEGELW-------------DDTLFMACLFLARAGVVCKRQ--DWIDEAVYQFMIHARY-------- 218  Agrobacterium fabrum...
Q8ZNU8 148 HGGMQHit--lAEENHQQMW-------------DDTLMMTVLPLAKIGKLLNRP--EYVEEATYQFLLHVQN-------- 202  Salmonella enterica ...
Q9KB74 125 ----WR-----EKIELFQAWgpegdlsnggriiVDCL-MNLPLLFWASEVTGNP--DYREAAIIHADKTRRFivrgddst 192  Bacillus halodurans
Q8A3J1 141 ----FQltygdATTLEHWTW-------------CDALFMAPPVYLKLYNITGDK--KFIRFMDKEYKATYEF-------- 193  Bacteroides thetaiot...
Q8A3N3 136 lwl------gaKNWSERWSW-------------CDALFMAPPVYGQLNKLYPEK--NYLDFMDREFREATDS-------- 186  Bacteroides thetaiot...
5NOA_A 154 ---------------DYWWW-------------ADGLYMVMPVMTKLYNITKNP--LYLEKLHEYLAYADSI-------- 195  Bacteroides thetaiot...
3K11_A 240 ----XFIPEKGLYRHGWVESSTDHPAF-------CWARANGWALLTACELLDV------LPE-DYPQRPKVXDYFRAHVR 301  Bacteroides thetaiot...
Q8EPL5 178 ----TKNKENGLYHHGWDEKAEQPWATssgrapeVWGRALGWYAMVLTYFLEL------LPQ-SHSKQQELQLVLSDLFD 246  Oceanobacillus iheye...
O31521 171 ----LQDPVTNLYYHAWDNKAQNHLSGi------YWGRANGWAALTMAKALPL------IEV-THPSFMIIDGSLRDQLS 233  Bacillus subtilis su...
Q9KDU1 171 ----LQDPETNFYYHGWDHLSQSNMSGi------FWARGNAWAAYTMAASLRM------IDV-KEPAFMEIHGSLRDLMS 233  Bacillus halodurans
Q7CV97 219 ----LSDPVTGLWYHGWTFNGRHNFADa------FWARGNSWITVAIPELFEL------VPTlAGKDKRFLANVLSSQVR 282  Agrobacterium fabrum...
Q8ZNU8 203 ----LMDKETGLWFHGWSYDGHHNFANa------RWARGNSWLTIVIPDFLELl----dLPE-NNAVRRYLVQVLNAQIA 267  Salmonella enterica ...
Q9KB74 193 yhtfYFNQETGEALRGGTHQGYEDGST--------WSRGQAWAIYGFAIAYRYtgneryLETaKRTAKYFIENLPADYV- 263  Bacillus halodurans
Q8A3J1 194 ----LFDKEENLFYRDHRYFDMkesn----gakvFWGRGNGWVLGGLVEMLRE------LPA-KSKYRPFYQELFQKLCY 258  Bacteroides thetaiot...
Q8A3N3 187 ----LYDADAGLYYRDRRYIPKkekn----gekvFWGRGNGWVFAGLPLLLQT------LPK-EHPTYNYYLNIYKEMAS 251  Bacteroides thetaiot...
5NOA_A 196 ----MYDEEAGLYYRDGKYVYPKHksvn--gkkdFWARGDGWVLAGLAKVLKD------LPE-TDKYRQEYIDRFRTLAK 262  Bacteroides thetaiot...
Q8EPL5 178 ----TKNKENGLYHHGWDEKAEQPWATssgrapeVWGRALGWYAMVLTYFLEL------LPQ-SHSKQQELQLVLSDLFD 246  Oceanobacillus iheye...
O31521 171 ----LQDPVTNLYYHAWDNKAQNHLSGi------YWGRANGWAALTMAKALPL------IEV-THPSFMIIDGSLRDQLS 233  Bacillus subtilis su...
Q9KDU1 171 ----LQDPETNFYYHGWDHLSQSNMSGi------FWARGNAWAAYTMAASLRM------IDV-KEPAFMEIHGSLRDLMS 233  Bacillus halodurans
Q7CV97 219 ----LSDPVTGLWYHGWTFNGRHNFADa------FWARGNSWITVAIPELFEL------VPTlAGKDKRFLANVLSSQVR 282  Agrobacterium fabrum...
Q8ZNU8 203 ----LMDKETGLWFHGWSYDGHHNFANa------RWARGNSWLTIVIPDFLELl----dLPE-NNAVRRYLVQVLNAQIA 267  Salmonella enterica ...
Q9KB74 193 yhtfYFNQETGEALRGGTHQGYEDGST--------WSRGQAWAIYGFAIAYRYtgneryLETaKRTAKYFIENLPADYV- 263  Bacillus halodurans
Q8A3J1 194 ----LFDKEENLFYRDHRYFDMkesn----gakvFWGRGNGWVLGGLVEMLRE------LPA-KSKYRPFYQELFQKLCY 258  Bacteroides thetaiot...
Q8A3N3 187 ----LYDADAGLYYRDRRYIPKkekn----gekvFWGRGNGWVFAGLPLLLQT------LPK-EHPTYNYYLNIYKEMAS 251  Bacteroides thetaiot...
5NOA_A 196 ----MYDEEAGLYYRDGKYVYPKHksvn--gkkdFWARGDGWVLAGLAKVLKD------LPE-TDKYRQEYIDRFRTLAK 262  Bacteroides thetaiot...
3K11_A 302 GVTALQS-GEGFWHQLLDCND---SYLETSATAIYVYCLAHAINKGWIdAIAYGPVAQLGWHAVAGK---INEEGQ--VE 372  Bacteroides thetaiot...
Q8EPL5 247 SLNRYQDeNSGLWYQVIDKGHledNWLESSCSCLFVYAMAKAVNNNYV-DKKYIKNAQKGYAGILKHstqVDSNNNlfLS 325  Oceanobacillus iheye...
O31521 234 ALVRLQD-ESGLWHTILDDPD---SYLEVSASAGIASALMSS-------GKLYTKYVQKSLAAILDA---VEEDGR--VS 297  Bacillus subtilis su...
Q9KDU1 234 ALLNVQS-EQGLWHTILTDPS---SYEETSGSAGIAAAL---VLQGAN-TPKGHHAAQRAFDALLEK---VDARGT--VL 300  Bacillus halodurans
Q7CV97 283 SLRKYQR-EDGMFHTLLDDPT---SPVETSATAGIAYGILRGIEAGIL-GEENRPHAERALKAVLGN---IDDEGV--VH 352  Agrobacterium fabrum...
Q8ZNU8 268 ALAKCQD-ESGLWHTLLDDPH---SYLEASATAGFAYGILKAVRKRYV-ERHYAQVAEKAIRGIVKH---ISPEGE--LL 337  Salmonella enterica ...
Q9KB74 264 ---AYWD-----FNAPITPDTkrdSSASAIASCGILELLSH-LQETDPdKAFFQQSVQKQMTSLVENy-aSEKDAQglIK 333  Bacillus halodurans
Q8A3J1 259 RIANLQS-SDGFWRASLLDPDa-yPSPETSCSGFFVYALAYGLNEGLLpKEKFLPVVEKGWKALLSA---VEEDGKlgYV 333  Bacteroides thetaiot...
Q8A3N3 252 SVIKCQD-KNGSWHASMLDPEs-yPSPENSASGFFVYGLGWGINQGILkGKKYKKAAQKGWKALKSY---VHEDGMlgYV 326  Bacteroides thetaiot...
5NOA_A 263 SVAACQQ-PEGYWTRSMLDAQh-aPGPETSGTAFFTYGLQWGVNNGFLdSAHYQPVVEKAWKYLSTVa--LQPDGKigYV 338  Bacteroides thetaiot...
Q8EPL5 247 SLNRYQDeNSGLWYQVIDKGHledNWLESSCSCLFVYAMAKAVNNNYV-DKKYIKNAQKGYAGILKHstqVDSNNNlfLS 325  Oceanobacillus iheye...
O31521 234 ALVRLQD-ESGLWHTILDDPD---SYLEVSASAGIASALMSS-------GKLYTKYVQKSLAAILDA---VEEDGR--VS 297  Bacillus subtilis su...
Q9KDU1 234 ALLNVQS-EQGLWHTILTDPS---SYEETSGSAGIAAAL---VLQGAN-TPKGHHAAQRAFDALLEK---VDARGT--VL 300  Bacillus halodurans
Q7CV97 283 SLRKYQR-EDGMFHTLLDDPT---SPVETSATAGIAYGILRGIEAGIL-GEENRPHAERALKAVLGN---IDDEGV--VH 352  Agrobacterium fabrum...
Q8ZNU8 268 ALAKCQD-ESGLWHTLLDDPH---SYLEASATAGFAYGILKAVRKRYV-ERHYAQVAEKAIRGIVKH---ISPEGE--LL 337  Salmonella enterica ...
Q9KB74 264 ---AYWD-----FNAPITPDTkrdSSASAIASCGILELLSH-LQETDPdKAFFQQSVQKQMTSLVENy-aSEKDAQglIK 333  Bacillus halodurans
Q8A3J1 259 RIANLQS-SDGFWRASLLDPDa-yPSPETSCSGFFVYALAYGLNEGLLpKEKFLPVVEKGWKALLSA---VEEDGKlgYV 333  Bacteroides thetaiot...
Q8A3N3 252 SVIKCQD-KNGSWHASMLDPEs-yPSPENSASGFFVYGLGWGINQGILkGKKYKKAAQKGWKALKSY---VHEDGMlgYV 326  Bacteroides thetaiot...
5NOA_A 263 SVAACQQ-PEGYWTRSMLDAQh-aPGPETSGTAFFTYGLQWGVNNGFLdSAHYQPVVEKAWKYLSTVa--LQPDGKigYV 338  Bacteroides thetaiot...
3K11_A 373 GTCVGTGXAFDpAFYYYRPVNVYAAHGYGPVLWAGAEXIRLL 414  Bacteroides thetaiotaomicron VPI-5482
Q8EPL5 326 DICIGTSIGDY-NYYVGRDTIKNDLHGVGAFILASVEMHKFF 366  Oceanobacillus iheyensis
O31521 298 RVSAGTAVMKNaEGYKQVPYKRIQGWGQGLALTFLADVLKTK 339  Bacillus subtilis subsp. subtilis str. 168
Q9KDU1 301 GVSTGTAVMNHaDGYRMTPNRRIEGWGQGLALTFFSHVLMRY 342  Bacillus halodurans
Q7CV97 353 GVSDGTPMGHDlDFYRRIPNLPT-PYGQALTMLLLIDV--FL 391  Agrobacterium fabrum str. C58
Q8ZNU8 338 QTSFGTGMGHDlDFYRHIPLTSM-PYGQAMAMLCLTEYLRNY 378  Salmonella enterica subsp. enterica serovar Typhimurium
Q9KB74 334 RGSYSVRIGH-----APDDYVIWGDY-------FYTEALMRL 363  Bacillus halodurans
Q8A3J1 334 QPIGADP--------KKVTRNMTEVYGPGAFLLAGTEMYRMA 367  Bacteroides thetaiotaomicron
Q8A3N3 327 QPVSAAP--------EQVTKDMTEVYGVGAFLMAGIEMLKMK 360  Bacteroides thetaiotaomicron
5NOA_A 339 QPIGEKAIPG-----QVVDANSTSNFGVGAFLLAACERVRYL 375  Bacteroides thetaiotaomicron
Q8EPL5 326 DICIGTSIGDY-NYYVGRDTIKNDLHGVGAFILASVEMHKFF 366  Oceanobacillus iheyensis
O31521 298 RVSAGTAVMKNaEGYKQVPYKRIQGWGQGLALTFLADVLKTK 339  Bacillus subtilis subsp. subtilis str. 168
Q9KDU1 301 GVSTGTAVMNHaDGYRMTPNRRIEGWGQGLALTFFSHVLMRY 342  Bacillus halodurans
Q7CV97 353 GVSDGTPMGHDlDFYRRIPNLPT-PYGQALTMLLLIDV--FL 391  Agrobacterium fabrum str. C58
Q8ZNU8 338 QTSFGTGMGHDlDFYRHIPLTSM-PYGQAMAMLCLTEYLRNY 378  Salmonella enterica subsp. enterica serovar Typhimurium
Q9KB74 334 RGSYSVRIGH-----APDDYVIWGDY-------FYTEALMRL 363  Bacillus halodurans
Q8A3J1 334 QPIGADP--------KKVTRNMTEVYGPGAFLLAGTEMYRMA 367  Bacteroides thetaiotaomicron
Q8A3N3 327 QPVSAAP--------EQVTKDMTEVYGVGAFLMAGIEMLKMK 360  Bacteroides thetaiotaomicron
5NOA_A 339 QPIGEKAIPG-----QVVDANSTSNFGVGAFLLAACERVRYL 375  Bacteroides thetaiotaomicron
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap