
Conserved Protein Domain Family

pfam05913: DUF871 (this model, PSSM-Id:399126 is obsolete and has been replaced by 461779)
Click on image for an interactive view with Cn3D
Bacterial protein of unknown function (DUF871)
This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
PSSM-Id: 399126
Aligned: 91 rows
Threshold Bit Score: 84.5201
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
2P0O_A                319 IQVTLVDLPKDEKVNTITRIIDKDQTILPLIKAGNQFTLV 358 Enterococcus faecalis V583
Q74HC9                312 IQILKVNLPASEKVNIVGKIIEKDIPLINLIKPSQEFILL 351 Lactobacillus johnsonii
Prjna32935:ECBG_01511 309 IQVCKRLLPADPKVNLAAQVIPADLPLIQQIKAGMRFKLE 348 Enterococcus casseliflavus EC20
WP_010719888          309 IQITKKDLPADEKVNRVAQISEAELPLLEQIRAGVNFKII 348 Enterococcus hirae
WP_013773257          308 IQIIKNQLPANEKVNIIGRVIEKDRDLLRHIKGGQKFRIE 347 Melissococcus plutonius
BAK95771              314 LQITKDDLPADEKVNVLAKVIEKDRNLIDYIDSGCRFELK 353 Tetragenococcus halophilus NBRC 12172
WP_014024448          309 TQVCKKALPAHPNINVVAYVIEKDRDLLDVIYSKQKFELK 348 Lactococcus garvieae
ELB70976              129 IQLTKYDLPADEKVNVVAKVIKEELPLINQIKAGMNYQFI 168 Enterococcus faecium EnGen0050
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap