1KWG


Conserved Protein Domain Family
Glyco_hydro_42

?
pfam02449: Glyco_hydro_42 
Click on image for an interactive view with Cn3D
Beta-galactosidase
This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
Statistics
?
PSSM-Id: 396834
Aligned: 28 rows
Threshold Bit Score: 346.952
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KWG_A              5 CYYPEHWPKERWKEDARRMREAGLSHVRIGEFAWALLEPEPGRLEWGWLDEAIATLAAEGLKVVLGTPTATPPKWLVDRY 84   Thermus t...
D9SM34              6 DYYPEHWDRQLWEKDAQLMKEIGVKVVRLAEFAWCKLEPIEGQYDFKWLDDVIEIFSVRNIEIVLGTPTNTPPLWLYEKY 85   Clostridi...
Q8FA02              6 DYYPEQWTRKDWEEDISIMKEMGLSSIRLAEFAWAMMEPKEGKYDFSFFDHILSLIQKNEMTAILGTPTATFPPWLAKKF 85   Leptospir...
Q8A069            332 YYYPEHWDESQWERDFKRMHELGFEFTHFAEFAWAQLEPEEGRYDFAWLDKAVALAAKYDLKVIMCTSTATPPVWMSRKY 411  Bacteroid...
P94804              6 CYFPEHWSRERWETDISQMAEAGIEYVRMGEFAWRRIEPERGTFDFAWLDEAVELIGKFGMKAVLCTPTATPPKWLVDEH 85   Haloferax...
Q92UN3              2 CYYPEQWPRGKWAEDARRMVELGLSWVRIGEFAWAKIEPRSGEFHWEWLDEAIDVLGKAGLKVILGTPTAAPPKWLVNRY 81   Sinorhizo...
Q6SF70             11 CYYPEHWPPEIWQCDAEKMVKAGLTWVRIGEFAWSRLEPQHGQYNWGWLDRAIDILGSAGLKVVLGTPTATPPRWIVDQN 90   unculture...
Q6BA77             11 CYYPEHWPEDLWQTDAEQMINLGLKWVRIGEFSWSRLEPKENEFSFEWFDRAIKTLGEAGLSIILGTPTATPPTWVIKKF 90   unculture...
CP000916:CTN_1379   5 CYYPEHWGVEKVEEDFRRMKELGIEYVRIGEFAWSRIEPERGKFNWEWLDRTLEAAERMGLKIILGTPTATPPKWLVDEH 84  
O31529              9 CYYPELWDEETIQQDIDIMREVGVNVVRIGEFAWSVMEPEEGKIDVGFFKEIIARLYDSGIETIMCTPTPTPPIWFSHGR 88   Bacillus ...
1KWG_A             85 PEILPVDREGRRRRFGGRRHYCFSSPVYREEARRIVTLLAERYGGLEAVAGFQTDNEYGCHDtVRCYCPRCQEAFRGWLE 164  Thermus t...
D9SM34             86 PDAIQVNESGERQFIGIRGHRCYNSSSMRKYTKAIVEAMTERYANNKAVIGWQIDNELDAT---HCCCDNCTEKFRGWLK 162  Clostridi...
Q8FA02             86 PDIIQ-ERDGIQRTIGTRRQACFSSPNYRKAVIKIVTAMAKHFGNHPVVIGWQIDNEIGHEGsDIDHSQTSLKAFRIWLK 164  Leptospir...
Q8A069            412 PEILLKNEDGTVLDHGARQHASFASPLYRELSYKMIEKLAQHYGNDSRIVGWQLDNEPAVQ---FDYNPKAEQAFRDYLR 488  Bacteroid...
P94804             86 PDVRQREQDGTPREWGSRRFTCFNSPTYRSETERIVSVLTDRYADNPHVAGWQTDNEFGCHEtVTCYCEDCGEAFSEWLA 165  Haloferax...
Q92UN3             82 PEILPVDATGAVRKFGARRHYCFSSRRYRSEAARITEAMARRYGEHIYVHAWQTDNEYGDHDtIYSYSAEAVGAFRLWLA 161  Sinorhizo...
Q6SF70             91 PDMLALDIDGRPRKFGARRHYCFSHIGYRQHCARIVTELAARYGENPYVAAWQTDNEYGCHDtTISYSAAARSAFQTWLH 170  unculture...
Q6BA77             91 PDMLALDADGRPRGFGSRRHYCFSHEGYRNQCSKIVRKLAERYGSNPYIQAWQTDNEYGCHDtTISYSSSALNSFQSWLA 170  unculture...
CP000916:CTN_1379  85 SEILPVDREGRVKNFGSRRHYCFSSPVYREEAKRIVSIVAGRYGKHPAVVGWQTDNEYGCHDtVRCYCPRCKKAFQKWLE 164 
O31529             89 PERMHANEKREIMGHGSRQHACTNNPYFRKKAAIITTAIAKELGRLPGLIGWQLDNEFKCHV-AECMCETCLRLWHDWLK 167  Bacillus ...
1KWG_A            165 ARY---------GT-IEALNEAWGTAFWSQRYRSFAEVELPHLTV-AEPNPSHLLDYYRFASDQVRAFNRLQVEILRAHA 233  Thermus t...
D9SM34            163 NKY---------ST-LENINKEYGNVVWSGEYSAWSQVTAPLGGS-PFLNPSYLLDYNRFASDSMVEYIDFQREIIRKNC 231  Clostridi...
Q8FA02            165 NKY---------KT-IQNLNETWGNVFWGMIFNSFEEIPIPGRHVaSNFHPSLIQDFYRFHSDTIIDFVKLQAQILRKFS 234  Leptospir...
Q8A069            489 AKY---------NHnIQLLNDAWGTAFWSEAYSSFDEITLPKRVQ-MFMNHHQILDYRRFAAAQTNDFLNEQCLLIRKYA 558  Bacteroid...
P94804            166 DRY---------ES-VADLNDAWGTTFWSQQYDDFESIDPPKPTP-AANHPSRVLAYERFSNDSVAEYNRLHAALIREAN 234  Haloferax...
Q92UN3            162 ERY---------GS-IDELNRAWGTSFWSMRYDSFEEIDLPNNLV-EEPSPTHGVDFIRFSSDQVKSFNKAQVDIIRAHS 230  Sinorhizo...
Q6SF70            171 NRYpgtdhasndGD-ITALNTAWGNVFWSMEYDNFEQIDLPNLTV-TEANPSHHLDFRRFTSEQVVSFNKLQTDIIRRRS 248  unculture...
Q6BA77            171 KIY---------GNdVNKLNEEWGNVFWSMEYQGYDEIPLPNLTV-TEPNPAHALAFRRFTSSQVTTFNRIQTQIIREYS 240  unculture...
CP000916:CTN_1379 165 RRYe--------GD-IDKLNRAWGTVFWSQEYRSFEEIELPNLTP-AGPNPSHLLDYYRFASDQVVEFNRLQVEIIRELS 234 
O31529            168 NRY---------GV-IERLNEAWGTDVWSETYQTFEQVPQPGPAP-FLHHASLRTMYQLFSMEMIASFADEQAKIIRCYS 236  Bacillus ...
1KWG_A            234 PGKFVTHNFMGF--FTDLDAFALAQDLDFASWDSYPLgftdl-mplpPEEKLryartgHPDVAAFHHDLYRGV--GRGR- 307  Thermus t...
D9SM34            232 PSQFITTNTWFT--GNLPNFYDAFENLDFVSYDNYPTtn-------eITDEE------ELHSHAFHCDLMRGI---KKKn 293  Clostridi...
Q8FA02            235 VGRPLTTNLYPSpfLPIIDMAELATYLDYISWDNYPT----------WGEQE------APFPHPFISAMQQYNrgLKNLp 298  Leptospir...
Q8A069            559 KNQWITTNYIP---NYDEGHIGGSPALDFQSYTRYMVyg------dnEGIGRrgyrvgNPLRIAWANDFFRPI---QGT- 625  Bacteroid...
P94804            235 DEWFVTHNFMG---GFSLDAFRLAADLDFLSWDSYPTgfvqdrqpdtPTVDElr--agNPDQVSMNHDLQRGA---KGKp 306  Haloferax...
Q92UN3            231 PGRPVTHNFMSQ--NTDFDHYRVGEDIDIASWDVYPMgglln-grlaAKDKEhylrvgDPDQPAFNHDLYRAV--GRGR- 304  Sinorhizo...
Q6SF70            249 PA-PIAHNYMGR--ITDFDHFDVGADLDIASWDSYPLgfledritatEAYKKkfarqgDPDFQAFHHDLYRAV--GRGR- 322  unculture...
Q6BA77            241 SA-PIIHNFMGR--ITDFDHFDVGEDLDIASWDSYPLgflldragatETEKNiflrqgDPDFQAFHHDLYRAV--CGGR- 314  unculture...
CP000916:CTN_1379 235 PGRFVTHNFMAG--FTDFDHYKISKDLDFASWDNYPLghtlvflrakGESKNpfnrvgHPDIISFSHDLYRGV--GRGR- 309 
O31529            237 -DAPITHNGSV---MFSVDNERMFQNLDFASYDTYAS-------------QE------NASAFLLNCDLWRNL--KQGRp 291  Bacillus ...
1KWG_A            308 FWVMEQQPG-PVNWAPHNPSPAPGMVRLWTWEALAHGAEVVSYFRWRQAPFAQEQMHAGLHRPDS-APDQGFFEAKRVAE 385  Thermus t...
D9SM34            294 FWIMEQLSGtPGCWMPMQRTPKPGMIKGYSFQAIGRGAETVVHFRWRNAIIGAEMFWHGILDHSN-VKGRRFYEFAELCR 372  Clostridi...
Q8FA02            299 FTVMEQISGfQGH-DLLGYLPAPGQTKLWMKHSIAHGSNAIYFFRYRTARFGQEQLCYGILDHDK-KKTERYYELQKGIQ 376  Leptospir...
Q8A069            626 YGVMELQPG-QVNWGSINPQPLPGAVRLWMWSVFAGGSDFICTYRYRQPLYGTEQYHYGIVGTDGvTVTPGGREYETFIK 704  Bacteroid...
P94804            307 FWVMEQQPG-DINWPPQSPQPADGAMRLWAHHAVAHGADAVVYFRWRRCRQGQEQYHAGLRRQDG-SPDRGYREASTAAD 384  Haloferax...
Q92UN3            305 VWVMEQQPG-PVNWAAHNQSPADGMVRLWTWLAYAHGVDMVSYFRWRQAPFAQEQFHAGLLLPNS-EADQGYLEVAEVVA 382  Sinorhizo...
Q6SF70            323 WWVMEQQPG-PVNWAPYNPAPLPGMVRLWTWEAFAHGAETVCYFRWRQVPFAQEQLHSGLLNPDS-SEAPGLAEARRVAD 400  unculture...
Q6BA77            315 WWVMEQQPG-PVNWAPYNPEPLPGMVRLWTWEAFAHGAETVSYFRWRQVPFAQEQMHSGLLQPNS-APAPGYFEARQVKE 392  unculture...
CP000916:CTN_1379 310 FWVMEQQAG-PVNWAPYNLWPAEGAVRLWTWQAFAHGAEVVSYFRWRQAPFAQEQMHSGLLAPDS-SPSQGYQEVKQVFE 387 
O31529            292 FWILETSPSyAASLESSAYPHADGYLQAEAVSSYALGSQGFCYWLWRQQRSGSEISHGSVLSAWG-EPTIGYQNVLAVER 370  Bacillus ...
1KWG_A            386 ELAAL 390  Thermus thermophilus
D9SM34            373 EVNKI 377  Clostridium cellulovorans 743B
Q8FA02            377 EIEKY 381  Leptospira interrogans
Q8A069            705 EIREL 709  Bacteroides thetaiotaomicron
P94804            385 ELFDL 389  Haloferax lucentense DSM 14919
Q92UN3            383 EMKRL 387  Sinorhizobium meliloti
Q6SF70            401 EIAKA 405  uncultured marine bacterium 582
Q6BA77            393 ELDAS 397  uncultured proteobacterium eBACred25D05
CP000916:CTN_1379 388 ELKGV 392 
O31529            371 ARKEI 375  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap