1N3L


Conserved Protein Domain Family
KOG2144

?
KOG2144: KOG2144 (this model, PSSM-Id:37355 is obsolete and has been replaced by 230083)
Click on image for an interactive view with Cn3D
KOG2144, Tyrosyl-tRNA synthetase, cytoplasmic [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 37355
View PSSM: KOG2144
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 21-Jun-2003
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N3L_A        2 GDAPSPEEKLHLITRNLQEVLGEEKLKEILKE--RELKIYWGTATTGKPHVAY-FVPMSKIADFLKAGCEVTILFADLHA 78
gi 7294108    1 MVGITPAEKKALITRNLQETLGDDKLTKILAE--RDLKIYWGTATTGKPHVAY-FVPMSKIADFLKAGCEVTILFADLHA 77
gi 25403336 474 RMSEEAEMKYKIVRSIGEECIQEDELKNLLAKk-PAPICYDGFEPSGRMHIAQgVMKVTNVNKLTSAGCQVKIWIADWFA 552
gi 25329540   1 -MSEEVEKRYKIVRSIGEECIQEEELKNLLAKk-AAPICYDGFEPSGRMHIAQgVMKVINVNKMTSAGCRVKIWIADWFA 78
gi 19173652   1 ---MSVEQKLYLITRNLQEILGEEELKRIVSE--RELNVYWGTAITGKPHIAY-LVPLMKIKDFVDAGCNVKILFADIHG 74
gi 3183174    1 -MSLTPDEKYELITRNLQEVLGAKMIREILNe--RDISLYWGSAPTGRPHCGY-FVPMMKLADFLKAGVHVTVLLADVHA 76
gi 549037     4 AATVDPNEAFGLITKNLQEVLNPQIIKDVLEVqkRHLKLYWGTAPTGRPHCGY-FVPMTKLADFLKAGCEVTVLLADLHA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N3L_A       79 YLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEH 158
gi 7294108   78 YLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEY 157
gi 25403336 553 QLNNKLGGDLERIRVVGEYFKEIWQAGGMNNDKVEFLWASDEINGKGSKYWPLVMDIARRNNLRRILRCGQIMGRSETEV 632
gi 25329540  79 QLNNKMGGDLKKIRVVGEYFQEIWKAAGMDNDKVEFLWSSEEINSKADKYWPLVMDIARKNKLPRILRCVQIMGRSETDE 158
gi 19173652  75 FLDNLKAPIEKVQHRCAYYEKLIKSALKMLCVDLDRIQFVKGSEFQKSERYTMDLYRILSITSKHDAKKAGAEVVRQVEN 154
gi 3183174   77 FLDNMKAPMELVQHRVRYYEIIVKSILKSLNIPIEKLRFVIGSSYQLKEDYTLDNFRLAASTTEHTARRAGAEVVKQVAS 156
gi 549037    83 FLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVAN 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N3L_A      159 PLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYS-KRVHLMNPMVPGLT--GSKMSSSEEESKIDLL 235
gi 7294108  158 PLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTFSEKYLPQLGYE-KRIHFMNPMVPGLA--GGKMSSSEEDSKIDLL 234
gi 25403336 633 LSAAQILYPCMQCADIFLLEADICQLGMDQRKVNMLAREYCADIKRKnKPIILSHHMLPGLQqgQEKMSKSDPSSAIFME 712
gi 25329540 159 LSAAQILYPCMQCADIFFLEADICQLGMDQRKVNVLAREYCDDIKRKnKPIILSHHMLPGLQqgQEKMSKSDPLSAIFME 238
gi 19173652 155 PMVSSLVYPSMQALDEVHLSVDAQFGGVDQRKIFTYARKYLPLLNYE-KRIHLMSPMLPGLN--SDKMSSSDDLSKIDLM 231
gi 3183174  157 PLLSSLIYPGMQALDEQYLGVDVQFGGVDQRKIFVMAEEVLPVLGYK-KRGHLMNPMVPSLAg-GKMSSSAAANAKIDIL 234
gi 549037   163 PLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYK-KRAHLMNPMVPGLAq-GGKMSASDPNSKIDLL 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N3L_A      236 DRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSE---F-----VILRDEKWGGNKTYTAYVDLEKDFAAEVVHPG 307
gi 7294108  235 DSPANVKKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEgegF-----EVNREAEHGGDVTFLKYEDLEKYYAEDKLHPG 309
gi 25403336 713 DEEADVNEKISKAYCPPKTVEGNPCLEYVKYIVLPRFNEfkvE---------SEKNGGNKTFNSFEDIVADYETGELHPE 783
gi 25329540 239 DEEAEVNVKIKKAYCPPKVVKGNPCLEYIKYIILPWFDEftvEr--------NEEYGGNKTYKSFEDIAADYESGELHPG 310
gi 19173652 232 DSKEAIWRKIRKCFCEE-GNKDNGLMMIFSHIVFPILQLkg------eCVRITDRDGREMAFEKYQEFEEEFVRKSIHPG 304
gi 3183174  235 DDPKTVNKKIRSAFCEPGVVEENGCLAFLKYVSFPAMELrgeTe---fVIDRPEQFGGRMVFKTYEEVEKAYKDLTLSPQ 311
gi 549037   241 EEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELkfgTnhfefFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPP 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N3L_A      308 DLKNSVEVALNKLLD-----------------------------PIREKFNT-PALKKLASAAYPDPS-------KQKPM 350
gi 7294108  310 DLKATVEKYINRLLD-----------------------------PIRKAFEN-PELQKLSAAAYPPPA-------KVKAG 352
gi 25403336 784 DLKKALMKALNITLQvrtfpsinddtlqqtmskqsllksvffskFLASVQSSwNMKLVSFQSLLDVRVinfmymnDMLLI 863
gi 25329540 311 DLKKGLMNALNKILQ-----------------------------VIP-MASNtSND--NFQHRPRQRNg----------P 348
gi 19173652 305 DLKSNAARLIDEIIR-----------------------------PIREEMEK---DLDMVREAYN--------------- 337
gi 3183174  312 DLKLGLESSVNTLLA-----------------------------GVQEQLKQyPDLDSILKAAYPDPKdl----kKAMKQ 358
gi 549037   321 DLKIGVADAINELLE-----------------------------PIRQEFANnKEFQEASEKGYP----------VATPQ 361

                ....*.
1N3L_A      351 AKGPAK 356
gi 7294108  353 AAPAAG 358
gi 25403336 864 VTVLSQ 869
gi 25329540 349 P-PPRR 353
gi 19173652     ------
gi 3183174  359 KKQDKK 364
gi 549037   362 KSKKAK 367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap