Conserved Protein Domain Family
KOG1954

?
KOG1954: KOG1954 (this model, PSSM-Id:37165 is obsolete and has been replaced by 229893)
KOG1954, Endocytosis/signaling protein EHD1 [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 37165
View PSSM: KOG1954
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 21-Jun-2003
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 281 MFSWLGG-----------------DS---SKKKNKE----------------------VLET------------------ 300
gi 7299809  382 epepepvvepeaevqpepvqqeeekaesaeakeeekpapveeaeaeeesvqpeaapkepeavqeeaqedepqtdgaqdaa 461
gi 18412957  74 SSHWHKK-----------------DMkllQTFSKAQ----------------------VSGKlhlklfesrgsdsvelpv 114
gi 7206819  232 MFSWLGG-----------------DS---SKKKNKE----------------------VLET------------------ 251
gi 17565130  35 MFSWLGG-----------------DS---SKKKNKE----------------------VLET------------------ 54
gi 13487775  17 MFSWLGG-----------------DS---SKKKNKE----------------------VLET------------------ 36
gi 9956076    1 MFSWVSK-----------------DA---RRKKEPE----------------------LFQT------------------ 20
gi 18202935   1 MFSWMGR-----------------QAggrERAGGAD----------------------AVQT------------------ 23
gi 18203333   1 MFSWLKR-----------------GG---ARGQQPE----------------------AIRT------------------ 20
gi 18203333   1 MFSWLKR-----------------GG---ARGQQPE----------------------AIRT------------------ 20
gi 18202945   1 MFSWVSK-----------------DA---RRKKEPE----------------------LFQT------------------ 20
gi 18203392   1 MFSWLGN-----------------DD---RRKKDPE----------------------VFQT------------------ 20
gi 9294546   73 FIVAMQLvslaqtgheishevlisDVdfkNINPPTMegspaadtsltahwfssksskkISlss----------------- 135
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 301 ---------------------------------------------------VSEGLRKIYKQKLLPLEEFHKFHDFHSPA 329
gi 7299809  462 dddddtkpedellweghipenrrsrqhitellqldeefnarekatdnvaeiiLRDIKRIYENAVKPLETLYKYRDLSNRH 541
gi 18412957 115 leglenvvskqkvsktnvdvednvvtkpqvtaktpwfksksiikpqvnvvtIVDGLKRLYTEKLKPLEVTYRFNDFASPV 194
gi 7206819  252 ---------------------------------------------------VSEGLRKIYKQKLLPLEEFHKFHDFHSPA 280
gi 17565130  55 ---------------------------------------------------VSEGLRKIYKQKLLPLEEFHKFHDFHSPA 83
gi 13487775  37 ---------------------------------------------------VSEGLRKIYKQKLLPLEEFHKFHDFHSPA 65
gi 9956076   21 ---------------------------------------------------VAEGLRQLYAQKLLPLEEHYRFHEFHSPA 49
gi 18202935  24 ---------------------------------------------------VTGGLRSLYLRKVLPLEEAYRFHEFHSPA 52
gi 18203333  21 ---------------------------------------------------VTSALKELYRTKLLPLEEHYRFGAFHSPA 49
gi 18203333  21 ---------------------------------------------------VTSALKELYRTKLLPLEEHYRFGAFHSPA 49
gi 18202945  21 ---------------------------------------------------VAEGLRQLYAQKLLPLEEHYRFHEFHSPA 49
gi 18203392  21 ---------------------------------------------------VSDGLKKLYKTKLLPLEEYYRFHEFHSPA 49
gi 9294546  136 ------------------------------------------------vtsIVDGLKRLYIQKLKPLEVAYRFNDFVSPL 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 330 LDD-----------PDFDAKPMILLVGQYSTGKTTFIRYLLESDFP--GIRIGPEPTTDRFIAVMHGDEEGSIPGNALVV 396
gi 7299809  542 FSD-----------PEIFSKPLILFMGPWSGGKSSILNYLTDNEYTpnSLRTGAEPSPAYFNILMWGNETEVLDGTQLAA 610
gi 18412957 195 LVSniltvsetltsSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYP--GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAV 272
gi 7206819  281 LDD-----------PDFDAKPMILLVGQYSTGKTTFIRYLLESDFP--GIRIGPEPTTDRFIAVMHGDEEGSIPGNALVV 347
gi 17565130  84 LDD-----------PDFDAKPMILLVGQYSTGKTTFIRYLLESDFP--GIRIGPEPTTDRFIAVMHGDEEGSIPGNALVV 150
gi 13487775  66 LDD-----------PDFDAKPMILLVGQYSTGKTTFIRYLLESDFP--GIRIGPEPTTDRFIAVMHGDEEGSIPGNALVV 132
gi 9956076   50 LED-----------ADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFP--GMRIGPEPTTDSFIAVMHGPTEGVVPGNALVV 116
gi 18202935  53 LED-----------ADFENKPMILLVGQYSTGKTTFIRYLLEQDFP--GMRIGPEPTTDSFIAVMYGETEGSTPGNALVV 119
gi 18203333  50 LED-----------ADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVP--GSRVGPEPTTDFFVAVMHGDTEGTVPGNALVV 116
gi 18203333  50 LED-----------ADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVP--GSRVGPEPTTDFFVAVMHGDTEGTVPGNALVV 116
gi 18202945  50 LED-----------ADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFP--GMRIGPEPTTDSFIAVMHGPTEGVVPGNALVV 116
gi 18203392  50 LED-----------ADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFP--GMRIGPEPTTDSFIAVMQGDVEGIIPGNALVV 116
gi 9294546  168 LTN-----------SDFDAKPMVMLLGQYSTGKTTFIKHLLKSTYP--GAHIGPEPTTDRFVVVMSGPDERSIPGNTVAV 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 397 DAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDI 476
gi 7299809  611 D--YTFAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDV 687
gi 18412957 273 QADMPFNGLTSFGGAFLSKFECSQMPHPVLDQITLVDTPGVLSGEKQRMQRSYDFTGVISWFASKCDMILLLFDPHKLDI 352
gi 7206819  348 DAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDI 427
gi 17565130 151 DAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDI 230
gi 13487775 133 DAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDI 212
gi 9956076  117 DPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDI 196
gi 18202935 120 DPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDI 199
gi 18203333 117 DPDKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQGVSRGYDFPAVLRWFAERVDLIILLFDAHKLEI 196
gi 18203333 117 DPDKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQGVSRGYDFPAVLRWFAERVDLIILLFDAHKLEI 196
gi 18202945 117 DPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDI 196
gi 18203392 117 DPKKPFRKLNAFGNAFLNRFVCAQLPNAVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDI 196
gi 9294546  235 QADMPFSGLTTFGTAFLSKFECSQMPHPLLEHVTFVDTPGVLSGEKQRTQRAYDFTGVTSWFASKCDLILLLFDPHKLDV 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 477 SDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQ-----LMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLN---- 547
gi 7299809  688 GPETEAILDQLKGREYQTRIILNKADTVKPEE-----LLRVQGALIWNISPLMSSAQPPLMYTTSLWTHPYQDGAP---- 758
gi 18412957 353 SDEFKRVITSLRGNEDKIRVVLNKADQVDTQQplflkLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPINEVAVgpig 432
gi 7206819  428 SDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQ-----LMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLN---- 498
gi 17565130 231 SDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQ-----LMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLN---- 301
gi 13487775 213 SDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQ-----LMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLN---- 283
gi 9956076  197 SDEFSEVIKALKNHEDKIRVVLNKADQIETQQ-----LMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDN---- 267
gi 18202935 200 SDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQ-----LMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDN---- 270
gi 18203333 197 SDEFSEAIGALRGHEDKIRVVLNKADMVETQQ-----LMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDN---- 267
gi 18203333 197 SDEFSEAIGALRGHEDKIRVVLNKADMVETQQ-----LMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDN---- 267
gi 18202945 197 SDEFSEVIKALKNHEDKIRVVLNKADQIETQQ-----LMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDN---- 267
gi 18203392 197 SDEFSEVIKALKNHEDKMRVVLNKADQIETQQ-----LMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDN---- 267
gi 9294546  315 SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQ-----LMRVYGALMWSLGKVLNTPEVSRVYIGSFSDKPINEAATgpig 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 548 RRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDK------IYEQ 621
gi 7299809  759 ARLLLAQERAFLRDLRTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLNTFNNHKTLFGNKKRIADDIIDhpqnyhIYEG 838
gi 18412957 433 KELFEKEQNDLLADLMDVPKKACDRKINEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEE------EFGK 506
gi 7206819  499 RRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDK------IYEQ 572
gi 17565130 302 RRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDK------IYEQ 375
gi 13487775 284 RRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDK------IYEQ 357
gi 9956076  268 RKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGE------IYQK 341
gi 18202935 271 RRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPE------IYIQ 344
gi 18203333 268 RRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPV------IFAK 341
gi 18203333 268 RRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPV------IFAK 341
gi 18202945 268 RKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGE------IYQK 341
gi 18203392 268 RKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDTKKKELVNNLAE------IYGR 341
gi 9294546  390 RELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLED------EFGK 463
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 622 LQREHNISPGDFPDVNKMREKLQTQDFSKFN-------PLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPagsngsaDP 694
gi 7299809  839 LSTLTNISRYDLPDPEVYRDFFRLNPLYEFKklrdtctYFRGCPITKLDLAIAYELPELAGKYKKMSEAALaaieaqqQD 918
gi 18412957 507 VRKISHLV------------------------------------------------------------------------ 514
gi 7206819  573 LQREHNISPGDFPDVNKMREKLQTQDFSKFN-------PLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPagsngsaDP 645
gi 17565130 376 LQREHNISPGDFPDVNKMREKLQTQDFSKFN-------PLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPagsngsaDP 448
gi 13487775 358 LQREHNISPGDFPDVNKMREKLQTQDFSKFN-------PLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPagsngsaDP 430
gi 9956076  342 IEREHQISPGDFPSLRKMQELLQTQDFSKFQ-------ALKPKLLDTVDDMLANDIARLMVMVRQEESLMP-------SQ 407
gi 18202935 345 LQREYQISAGDFPEVKAMQEQLENYDFTKFH-------SLKPKLIEAVDNMLSNKISPLMNLISQEETSTP-------TQ 410
gi 18203333 342 IQLEHHISPGDFPDCQKMQELLMAHDFTKFH-------SLKPKLLEALDEMLTHDIAKLMPLLRQEELEST-------EV 407
gi 18203333 342 IQLEHHISPGDFPDCQKMQELLMAHDFTKFH-------SLKPKLLEALDEMLTHDIAKLMPLLRQEELEST-------EV 407
gi 18202945 342 IEREHQISPGDFPSLRKMQELLQTQDFSKFQ-------ALKPKLLDTVDDMLANDIARLMVMVRQEESLMP-------SQ 407
gi 18203392 342 IEREHQISPGDFPNLKKMQDQLQAQDFSKFQ-------PLKSKLLEVVDDMLAHDIAQLMVLVRQEETQRP-------VQ 407
gi 9294546  464 VQREHHLPKGDFPNVDHFREVLSGYNIDKFE-------KLKPKMLQTVDDMLGYDIPELLKNFKNPYD------------ 524
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17565132 695 TVRGGAFSQTTEAET---PFGFGR-----GEGfdkgADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLP 766
gi 7299809  919 GTIGQAEPKRTS-------------------------------------------------------------------- 930
gi 18412957     --------------------------------------------------------------------------------
gi 7206819  646 TVRGGAFSQTTEAET---PFGFGR-----GEGfdkgADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLP 717
gi 17565130 449 TVRGGAFSQTTEAET---PFGFGR-----GEGfdkgADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLP 520
gi 13487775 431 TVRGGAFSQTTEAET---PFGFGRydarwGEGfdkgADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLP 507
gi 9956076  408 VVKGGAFDGTMNGPFg-hGYGEGA-----GEG----IDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLP 477
gi 18202935 411 LVQGGAFDGTTEGPFn-qGYGEGA-----KEG----ADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP 480
gi 18203333 408 GVQGGAFEGTHMGPFverGPDEAM-----EDGeegsDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLP 482
gi 18203333 408 GVQGGAFEGTHMGPFverGPDEAM-----EDGeegsDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLP 482
gi 18202945 408 VVKGGAFDGTMNGPFg-hGYGEGA-----GEG----IDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLP 477
gi 18203392 408 MVKGGAFEGTLQGPFg-hGYGEGA-----GEG----IDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLP 477
gi 9294546      --------------------------------------------------------------------------------
                       650       660       670       680       690
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 17565132 767 NSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRGEQ 823
gi 7299809      ---------------------------------------------------------
gi 18412957     ---------------------------------------------------------
gi 7206819  718 NSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRGEQ 774
gi 17565130 521 NSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRGEQ 577
gi 13487775 508 NSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRGEQ 564
gi 9956076  478 NTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSSAWGH 534
gi 18202935 481 NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSL 537
gi 18203333 483 NSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHK 539
gi 18203333 483 NSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHK 539
gi 18202945 478 NTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE 534
gi 18203392 478 NSVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLLPPYKRKVS 534
gi 9294546      ---------------------------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap