Conserved Protein Domain Family
KOG1486

?
KOG1486: KOG1486 (this model, PSSM-Id:36699 is obsolete and has been replaced by 229427)
KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]
Statistics
?
PSSM-Id: 36699
View PSSM: KOG1486
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 21-Jun-2003
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465736     1 MGILEKIAEIEHEISRTQKNKATEYHLGLLKAKLAKYRQQLLEPTGKGGA-KGEGFDVMKSGDARVAMVGFPSVGKSTLL 79
gi 7300535    1 MGILEKIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEPSKKGE--KGDGFDVLKSGDARVALIGFPSVGKSTML 78
gi 15220113   1 MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASG-GGEGFEVTKYGHGRVALIGFPSVGKSTLL 79
gi 15218561   1 MGIVERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSG-GGDGFEVTKYGHGRVALIGFPSVGKSTLL 79
gi 19173454   1 MGIQDKINEIEAEMARTQKNKKTEHHLGALKAKLARYRQELDVPKTRSS--KSDGFEVSKSGDARVVLIGLPSVGKSTLL 78
gi 1706518    1 MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASS-KGEGFDVMKSGDARVALIGFPSVGKSTFL 79
gi 12644208   1 MGVLEKIQEIEAEMRRTQKNKATEYHLGLLKGKLAKLRAQLLEPTSKSGP-KGEGFDVLKSGDARVAFIGFPSVGKSTLL 79
gi 1723727    1 MGIIDKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLADEAGSGGgGGSGFEVAKSGDARVVLIGYPSVGKSSLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465736    80 SSMTSTHSEAAGYEFTTLTCIPGVISYNGANIQLLDLPGIIEGASQGKGRGRQVISVAKTADLILMMLDAGKSDQQKMLL 159
gi 7300535   79 STLTKTESEAANYEFTTLTCIPGVIEYQGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLDATKPNVHRELL 158
gi 15220113  80 TMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQIL 159
gi 15218561  80 TMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQIL 159
gi 19173454  79 SKITSTHSKAAEHEFTTLECISGKMHLNDTWIQVLDLPGIVSGASQNRGRGRQVISIARTADLILMVLDPRRHEDRR-IL 157
gi 1706518   80 SLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADVIIMMLDATKGEVQRSLL 159
gi 12644208  80 SAITKTKSATASYEFTTLTAIPGVLEYDGAEIQMLDLPGIIEGASQGRG-GRQAVSAARTADLILMVLDATKAADQREKI 158
gi 1723727   81 GKITTTKSEIAHYAFTTLTSVPGVLKYQGAEIQIVDLPGIIYGASQGKGRGRQVVATARTADLVLMVLDATKSEHQRASL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465736   160 ERELEAVGIRLNKKPPNIYVKQKKVGGVKFTNTVP-LTHCNEKLIMTVLHEYKIFNADVIFRED-CTVDEFIDVI-QGNR 236
gi 7300535  159 ERELESVGIRLNKRKPNIYFKQKKGGGLSFNATCS-LTRCNEKMVQTILHSFKIFNAEVLFRED-CTEDEFIDVV-TANR 235
gi 15220113 160 TKELEAVGLRLNKTPPQIYFKKKKTGGISFNTTAP-LTHIDEKLCYQILHEYKIHNAEVLFREN-ATVDDFIDVI-EGNR 236
gi 15218561 160 TKELEAVGLRLNKRPPQIYFKKKKTGGISFNTTTP-LTRIDEKLCYQILHEYKIHNAEVLFRED-ATVDDFIDVV-EGNR 236
gi 19173454 158 EDELHEMGIRLNKRKPDVSLTCTTSNGINIGITCQ-LTKTTEATIRAILKEYKINNCQMFVRED-VSDDDIIDLI-SGSA 234
gi 1706518  160 EKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVT-LTQCSEKLVQLILHEYKIFNAEVLFRED-CSPDEFIDVI-VGNR 236
gi 12644208 159 EYELEQVGIRLNRQPPNVTLTIKKNGGIKFNHTVP-LTHMDYKMAYNILHEYRIHNADILIRED-ITVDDFIDLV-MGNR 235
gi 1723727  161 EKELENVGIRLNKEKPNIYYKKKETGGVKVTFTSPpKTNLTEQAIKMILRDYRIHNAEVLVRDDqCTIDDFIDVInEQHR 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 465736   237 VYMTCLYVYNKVDQISIEEIDRLARMPHHVVISCEMNLNMDYLLEKMWEYLALVRVYTKKPGNAPDLGpeDGIILR---G 313
gi 7300535  236 VYLPCLYVYNKIDQISIEEVDRLARQPNSIVVSCNMKLNLDYMMEALWEALQLIRVYTKKPGAPPDFD--DGLILR---K 310
gi 15220113 237 KYIKCVYVYNKIDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQPDFD--EPFVLSsdrG 314
gi 15218561 237 KYIKCVYVYNKIDVVGIDDVDRLARQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQSQQPDFD--EPFVLSadrG 314
gi 19173454 235 VYVDCLYVYNKIDELSLEDFNRVAEQPNSTVISCRRNWNISRLLEDIWDKLKLTRVYTKKKGAFPSLD--DPVVIR---K 309
gi 1706518  237 VYMPCLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQRPDFT--DAIILR---K 311
gi 12644208 236 RYINCLYCYSKIDAVSLEEVDRLARLPKSVVISCNMKLNLDFLKERIWEELNLYRIYTKRKGEMPDFS--EALIVR---K 310
gi 1723727  241 NYVKCLYVYNKIDAVSLEEVDKLAREPNTVVMSCEMDLGLQDVVEEIWYQLNLSRVYTKKRGVRPVFD--DPLVVR---N 315
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|...
gi 465736   314 GATIEHCCHALHRSIAAQLRYAIVWGTSTKFSPQRVGLHHKLDHEDVIQIMRR 366
gi 7300535  311 GVSVEHVCHAIHRTLAAQFKYALVWGTSTKYSPQRVGIAHVMADEDVIQVVKK 363
gi 15220113 315 GCTVEDFCNHVHRTLVKDMKYALVWGTSTRHNPQNCGLSQHLEDEDVVQIVKK 367
gi 15218561 315 GCTVEDFCNQVHRTLVKDMKYALVWGTSARHYPQHCGLFHHLEDEDVVQIVKK 367
gi 19173454 310 GGTVKDLCSRIHKDFLLSFKHALVWGTSAKHSPQRVGLGHTLEDEDVVQIFLR 362
gi 1706518  312 GASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQIVKK 364
gi 12644208 311 GSTIEQVCNRIHRTLAEQLKYALVWGTSAKHSPQVVvglnhrveegdvvtivt 363
gi 1723727  316 NSTIGDLCHGIHRDFKDKFKYALVWGSSAKHSPQKCGLNHRIDDEDVVSLFAK 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap