Conserved Protein Domain Family
KOG1270

?
KOG1270: KOG1270 (this model, PSSM-Id:36484 is obsolete and has been replaced by 229212)
KOG1270, Methyltransferases [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 36484
View PSSM: KOG1270
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 21-Jun-2003
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12052971  62 KSYRTIFSC--LNRIKSFRYPWAR-----LYSTSQTTVDS--GEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIR--D 130 human
21264383  39 TSDTDASAAsfSSSHPKIQTLEGKasnksRSTSSTTSLNE--DELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIR--S 114 thale cress
15234905  37 TVVAASVTDlaGVDSTTIAVLGGGs---vAALAAMVSLTDp-ERRRKLQAEEVGGGDKEVVREYFNSTGFERWRKIYgeT 112 thale cress
17543762   1 ---MIPSRS--ARIIAKLQRLHST-----TSAASVSSIDV--KEVEKFGDLSAEWADELGPFHALHSLNRIRVPWIV--D 66  Caenorhabditis elegans
17367011   3 KSYRTIFSC--LNRIKSFRYPWAR-----LYSTSQTTVDS--GEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIR--D 71  human
19113493   1 ------MSDivYANVSHYNKIEASk----YDNPSTLAISK----VISSKILQFEDNSETSLRHDLPKYDQDRLLLTS--D 64  fission yeast
7673982    1 ---MNILNK--VKNVKSYTRLVRQg---fLSQQRNHSVSV--NEVDHFNELAKTWWDWDGGSRLLHLMNSTRLDFMT--E 68  fission yeast
116930     1 MGFIMLLRSrfLKVIHVRKQLSACsrfaiQTQTRCKSTDAseDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQ--R 78  baker's yeast
22946973   1 ---mmrnallvsgklrhllscsigrnstrssstaksldagtqkevrhhenhasewwnqngtMGALHALNEIRVPFIR--D 75  fruit fly
12052971 131 NLLKTIPN-----HQPG-----------------------KPLLGMK-----ILDVGCGGGLLTEPLGRLG--ASVIGID 175 human
21264383 115 TLCRHFSK------DPSs---------------------aKPFEGLK-----FIDIGCGGGLLSEPLARMG--ATVTGVD 160 thale cress
15234905 113 DEVNRVQKdirlgHAKTven-----------------tmlMLTEDRSlagvtVCDAGCGTGLLSIPLAKEG--AIVSASD 173 thale cress
17543762  67 NVRKSD-Q-----KAPP----------------------------R------LVDVGSGGGLLSIPLARSG--FDVTGID 104 Caenorhabditis elegans
17367011  72 NLLKTIPN-----HQPG-----------------------KPLLGMK-----ILDVGCGGGLLTEPLGRLG--ASVIGID 116 human
19113493  65 DDLTNVNN-----FWKKs--------------------------GMS-----ILDFACGTGLISQHLFPYC--KQIVGID 106 fission yeast
7673982   69 VFRERN-------CFSG----------------------------KK-----ILDIGCGGGILSESMARLG--ASVTAVD 106 fission yeast
116930    79 TVRNQVKIqnpeiFVPGfnykeflpeyvcdniqremqesiETNLDKRpe-vsVLDVGCGGGILSESLARLKwvKNVQGID 157 baker's yeast
22946973  76 GIVSRG-T-----VKPGyvn------------------ttKVLLGQN-----ILEVGCGGGLLTEHLARLG--AQVAGID 124 fruit fly
12052971 176 PVDEDIKTAQCH-KSFDPVLDKRIEYRVCSLEEIVEETAET------FDAVVASEVVEHVIDLETFLQCCCQVLKPG-GS 247 human
21264383 161 AVDKNVKIARLH-ADMDPVTST-----IEYLCTTAEKLADEgr---kFDAVLSLEVIEHVANPAEFCKSLSALTIPN-GA 230 thale cress
15234905 174 ISAAMVAEAEMKaKAQLPSENLP----K-FEVNDLESLTGK------YDTVVCLDVLIHY--PQNKADGMIAHLASL--- 237 thale cress
17543762 105 ATKQAVEAANQS-LTAKPLQIAGISKRLRFEHTSVEDFCQKphnksaYDAVVASEIVEHVADLPGFIGCLAELARPG-AP 182 Caenorhabditis elegans
17367011 117 PVDENIKTAQCH-KSFDPVLDKRIEYRVCSLEEIVEETAET------FDAVVASEVVEHVIDLETFLQCCCQVLKPG-GS 188 human
19113493 107 VSQDMVDVYNEKfRKMNIPKERACAYVLSLDDLDGNGDEPFst---eFDAVVCSMAYHHIKDLQEVTNKLSKLLKPN-GR 182 fission yeast
7673982  107 ASPMAIEVAKKH-ASLDPVLNG----RLEYIHGSVEGSQLPt----tFDVVTCMEVLEHVEQPRDFLFSLMEKVKPN-GR 176 fission yeast
116930   158 LTRDCIMVAKEH-AKKDPMLEG----KINYECKALEDVTGQ------FDIITCMEMLEHVDMPSEILRHCWSRLNPEkGI 226 baker's yeast
22946973 125 LGEKLIEAAREHlKCSSPELASNVVYKIEPVDQHAKANCEC------YDAVIVSEVLEHVKDKVSLLEASVRSLKPG-GS 197 fruit fly
12052971 248 LFITTINKTQLSYALGIVFSEQIAS-IVPKGTHTWEKFVSPETLESILES---------------------N---GLSVQ 302 human
21264383 231 TVLSTINRTMRAYASTIVGAEYILR-WLPKGTHQWSSFVTPEEMSMILQR---------------------A---SVDVK 285 thale cress
15234905 238 ----AEKRVILSFAPKTFYYDILKR--------IGELFPGPSKATRAYLH---------------------S---EADVE 281 thale cress
17543762 183 LFITTINRTWLSKLAAIWLAENVLK-IVPPGVHDWEKFITPAELTSHLEK---------------------A---GCRVT 237 Caenorhabditis elegans
17367011 189 LFITTINKTQLSYALGIVFSEQIAG-IVPKGTHTWEKFVSPETLESILES---------------------N---GLSVQ 243 human
19113493 183 LFVADLIKGGDTFHGNLHPDEIAKLgVAHHGGFTPQSILNLFKNASLSNA---------------------EvigKAQAN 241 fission yeast
7673982  177 LVLSTISRTLLARLLTITLAEHVLR-IVPVGTHTFEKFIRADELSNFLKE---------------------Q---NWIIN 231 fission yeast
116930   227 LFLSTINRDLISWFTTIFMGENVLK-IVPKGTHHLSKYINSKEILAWFND---------------------NysgQFRLL 284 baker's yeast
22946973 198 IFITTLNKTIPSWFGGVLLSEYVLN-LVPRGTHHWDKMISPLDVQRILDTskfisgfifrlgyslfsrssaV---NCQTV 273 fruit fly
12052971 303 TVVGMLYNPFSGYWHWSENTSLNYAAHAVKSRVQEHP 339 human
21264383 286 EIAGFVYNPITGRWLLSDDISVNYIAYGTKRKDLGDI 322 thale cress
15234905 282 RALGKVGWKISKRGLTTTQFYFSRLIEAVPM------ 312 thale cress
17543762 238 AVHGLMFHPVGNHWTWIESTQCNYGILAVKN------ 268 Caenorhabditis elegans
17367011 244 TVVGMLYNPFSGYWHWSENTSLNYAAHAVKSRVQEHP 280 human
19113493 242 VWVDEAKYQRSTQSKDAKTLDLANGEKLYEVKLQLMV 278 fission yeast
7673982  232 DIRGVCYNPLKQQWTLDKPGSSGLGLSCNYFLSAQKP 268 fission yeast
116930   285 DLKGTMYLPYQG-WVEHDCSDVGNYFMAIQRLN---- 316 baker's yeast
22946973 274 LVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQREYN 310 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap