Conserved Protein Domain Family
KOG0326

?
KOG0326: KOG0326 (this model, PSSM-Id:35547 is obsolete and has been replaced by 228275)
KOG0326, ATP-dependent RNA helicase [RNA processing and modification]
Statistics
?
PSSM-Id: 35547
View PSSM: KOG0326
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 20-Jun-2003
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225898  67 YVQRG-YPQQIQQQQq---LQQQQQQQQQQQEQQWSRRAQLPGDPSYIDEVe---KTVQSEAISDsNNEDWKATLKLPPR 139 thale cress
22946108   1 ------------------mMTEKLNSGHTNLTSKGIINDLQIAGNTSDDMG-------------------WKSKLKLPPK 43  fruit fly
15233064  39 YVQRG-YSQNPQQ------MQLQQQHQQQQQQQQWSRRPQLPGNASNANEVv--qQTTQPEASSDaNGQDWKATLRLPPP 109 thale cress
7436453   38 YVQRGnYAQNHQQQFqqapSQPHQYQQQQQQQQQWLRRGQIPGGNSNGDAVveveKTVQSEVIDP-NSEDWKARLKLPAP 116 thale cress
17552114   1 --------------------------------MSGAEQQQIVPANNGDEN--------------------WKAGLNLPAK 28  Caenorhabditis elegans
19173285  15 KKGRRnDRKDSWDKDgftqRGRAEKKPVDLAKIQGIQGQIGIGKNKGDGNR----LDCGMDKEEAeDGKDIMRCRHLSPG 90  Encephalitozoon cun...
20555745   9 AVIMGlSSQNGQLRG----PLKPSGGPRGEATQTQQQTNQLKNTNTI--------------------------------- 51  human
1174456    1 ------------------------------MAESLIQKLENANLN---DRE------------------SFKGQMKAQPV 29  fission yeast
729329     1 ------------------------------MGS--INNNFNTNNNSNTDLDr-----------------DWKTALNIPKK 31  baker's yeast
129376     9 pviMGlSSQNGQLRG----PVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTq---QQAQSMTTTIkPGDDWKKTLKLPPK 81  human
15225898 140 D---NRYQTEDVTATKGNEFEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPTLEKI 216 thale cress
22946108  44 D---NRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQI 120 fruit fly
15233064 110 D---TRYQTADVTATKGNEFEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPVLEKI 186 thale cress
7436453  117 D---TRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKTAAFCIPVLEKI 193 thale cress
17552114  29 D---RRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKI 105 Caenorhabditis elegans
19173285  91 GggmKRLLSEDVRETEGIGWESLGLGPVLLKRIRDIGYDFPSPVQVASIPHVLGGKNLLVRSKNGTGKTASYIVPMLNMI 170 Encephalitozoon cun...
20555745  52 ------IALN------------H--KRRLLMRIFEMGWKKPSPFQEESIPIALSGRDILARAKNGTGKSSAHDIPLLKRL 111 human
1174456   30 D---MRPKTEDVTKTRGTEFEDYYLKRELLMGIFEAGFERPSPIQEESIPIALSGRDILARAKNGTGKTAAFVIPSLEKV 106 fission yeast
729329    32 D---TRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKV 108 baker's yeast
129376    82 D---LRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERL 158 human
15225898 217 DPENNVIQAVILVPTRELALQTSQVCKELSKYLK-IEVMVTTGGTSLRDDIMRLYQPVHLLVGTPGRILDLAKKGVCVLK 295 thale cress
22946108 121 DPTKDYIQALVMVPTRELALQTSQICIELAKHLD-IRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMS 199 fruit fly
15233064 187 DPNNNVIQAMILVPTRELALQTSQVCKELSKYLN-IQVMVTTGGTSLRDDIMRLHQPVHLLVGTPGRILDLTKKGVCVLK 265 thale cress
7436453  194 DQDNNVIQGNCVLD------HTSQVCKELGKHLK-IQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLK 266 thale cress
17552114 106 QPALKAIQAMVIVPTRELALQTSQICVELSKHIQ-LKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKME 184 Caenorhabditis elegans
19173285 171 NSSELSIQGIILVPIRELALQISRNVKRMSEGTG-VISAPVVGGTSMQDDIIRVSNGVHVMVGTPGRIVDLVEKRVGTLS 249 Encephalitozoon cun...
20555745 112 DLKKDTIQTIVIVPTGGPALQVSQICIQVSKHMGgVKVVMTTGGTNSGDDVLRLDDTVHMVIAAPGRILNLIKKGVA--- 188 human
1174456  107 DTKKSKIQTLILVPTRELALQTSQVCKTLGKHMN-VKVMVTTGGTTLRDDIIRLNDTVHIVVGTPGRVLDLAGKGVADFS 185 fission yeast
729329   109 KPKLNKIQALIMVPTRELALQTSQVVRTLGKHCG-ISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLS 187 baker's yeast
129376   159 DLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGgAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVD 238 human
15225898 296 DCAMLVMDEADKLLSVEFQPSIEELIQFLPESRQILMFSATFPVTVKSFKDRYLKKPYIINLMDQLTLMGVTQYYAFVEE 375 thale cress
22946108 200 HCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQE 279 fruit fly
15233064 266 DCAMLVMDEADKLLSAEFQPSLEELIQFLPQNRQFLMFSATFPVTVKAFKDRHLRKPYVINLMDQLTLMGVTQYYAFVEE 345 thale cress
7436453  267 DCSVLVMDEADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVTVKDFKDRFLTNPYVINLMDELTLKGITQFYAFVEE 346 thale cress
17552114 185 HCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYAFVQE 264 Caenorhabditis elegans
19173285 250 KRVILVFDEADKLLDVTFGETVTKLLDLLPREKQMLLYSATFPYFVTGFIRRYMKNPLCINLMKELAPVGVKQFYTYVKP 329 Encephalitozoon cun...
20555745 189 --------------------------------------------------------------------KDITQYYAYVTE 200 human
1174456  186 ECTTFVMDEADKLLSPEFTPIIEQLLSYFPKNRQISLYSATFPLIVKNFMDKHLNKPYEINLMDELTLRGVTQYYAFVDE 265 fission yeast
729329   188 DCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEE 267 baker's yeast
129376   239 HVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEINLMEELTLKGVTQYYAYVTE 318 human
15225898 376 RQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMVQDHRNRVFHDFRNGACRNLVCTDLFTRGI 455 thale cress
22946108 280 RQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGI 359 fruit fly
15233064 346 RQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMVQDHRNRVFHEFRNGACRNLVCTDLFTRGI 425 thale cress
7436453  347 RQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGI 426 thale cress
17552114 265 KQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGI 344 Caenorhabditis elegans
19173285 330 SEKLLCLKSLLLRLSINQCVIFCNSIKTVELLAMKITEMGLPSYFIHSKMAQEDRNIVFHNFLKGKCKILVATDLITRGV 409 Encephalitozoon cun...
20555745 201 HQKVHGLTTLFSRLQLNQMIIFFNCSQRVEWPAK-ISQLG---------------------------------------I 240 human
1174456  266 SQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCFYSHAKMLQSHRNRVFHNFRNGVCRNLVCSDLLTRGI 345 fission yeast
729329   268 RQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGI 347 baker's yeast
129376   319 RQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGI 398 human
15225898 456 DIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ 528 thale cress
22946108 360 DVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVA 432 fruit fly
15233064 426 DIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ 498 thale cress
7436453  427 DIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ 499 thale cress
17552114 345 DIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVA 417 Caenorhabditis elegans
19173285 410 DAPNTNYVINFDISKSPESYLHRIGRAGRFGAPGVAISLVTTEEKEMLMDIEAKLGKEISPLS---DKGLSRL 479 Encephalitozoon cuniculi
20555745 241 DIQAVNVVINFDFSKLEETYLRHIGRPGHFGHFGLAINLITYGDHFNLKGIEEQLGKEIKPIPSNIDKSLHVA 313 human
1174456  346 DIQAVNVVINFDFPKNAETYLHRIGRSGRFGHRGLAISFISWADRFNLYRIENELGTEIQPIPPSIDPSLYVF 418 fission yeast
729329   348 DIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVA 420 baker's yeast
129376   399 DIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVA 471 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap