Conserved Protein Domain Family
COG4584

?
COG4584: COG4584 (this model, PSSM-Id:34222 is obsolete and has been replaced by 226950)
Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 34222
View PSSM: COG4584
Aligned: 97 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890093  61 RVGAAPSTVRETLRRLERAGLSWPLAEDVSDAVLEAALYKAAg------tKTGHRRIAEPDWAQVHRELKRKHVTLQILW 134
gi 15890128   4 YLKVRLAVSEGMTRRQAAKYFNISRDSVAKMVSYSTPPGYQR--------QLPIRRPKLDAFVSTIDHWLDEDVKVPRKQ 75
gi 15616527   3 YVKIHELRKRKFKVAQIAKELKVSRPTVYKYLDMTFDEAKAYteq---plGKKRKLDPYKDWILAWLEEYPHLSSAQIHD 79
gi 15803508     --------------------------------------------------------------------------------
gi 15842491   1 -------------------------------------------------------------------------MLTVEDW 7
gi 2497387    1 MATIAQRLRDDHGVAASESSVRRWIATHFAEEVARERVTVPRg-------PVDAGSEAQIDYGRLGMWFDPATARRVAVW 73
gi 15610773   1 --------------------------------------------------------------------------MPGRVF 6
gi 15927380     --------------------------------------------------------------------------------
gi 16262873  10 SAPRMERVRNLKLYAGLSVSTNCSPGLERRRKWKLRFVSSNVgcwagcaiAHSIVWPRSMRRLANCSMISMISAFCAVSA 89
gi 18450289   2 RKDVLEGVLLHIMNEIHPNFAALAKQYNCDYRTVKRYYEAGLtgd---ldKLRERKPSVPPLLHGFEEIIRDKLELNC-- 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890093 135 DEYIGLHPEGYRYSRYCDLYRHWALKLPVTMRQDHAAGEKLFVDYAGDTVSVVIDRLSGK------TRQAHVFVGVLGAS 208
gi 15890128  76 RHTAKRVFDRLRDERGFTGGYTIIKDYMRERDQRRQEVFVPLAHPPGHGQADFGEALVVIgg---vERKAHFFVLDLPHS 152
gi 15616527  80 WLLERYPDLVVGGSTVRTYVKDIREVYQIEKKVMIRQYEAVPEQPMGKQLQVDWGETKQKttd-nkEIKLYFIAFVLAHS 158
gi 15803508   1 --------------------MNSQTKKDIPCFRSYLPDALRLRFEDKLTIRAIAQRLGLS------HSTIHTLFQRFIAS 54
gi 15842491   8 AEIRRLH----RAEGLPIKMIARVLGISKNTVKSALESNQQPKYERAPQG-SIVDAVEPR------IRELLQAYPTMPAT 76
gi 2497387   74 AFVMVLAFSRHLFVRPVIRMDQTAWCACHVAAFEFFDGVPARLVCDNLRTGVDKPDLYDPq-----INRSYAELASHYAT 148
gi 15610773   7 ASPADFN---TQLQAWLVRANHRQHRVLGCRPADRIEADTAAMLTLPPVGPSIGWRTSTRl-----PRDHYVRLDGNDYS 78
gi 15927380   1 ----------------MKLSLDINTDFEVTTLTDLPKLKIVMENLNMKINKSEIARHMGVyrr-tvDKYLNGFEPTKKRN 63
gi 16262873  90 PPAANCSRSLIVRPLRPLPVERYVFAEWRIRRAGLDYHVEIERHYYSVPYRFAREQVEAR------ITANTIEIFHKGER 163
gi 18450289  77 --SAASIFYFLGKKDYKGSYTTIKRYCRKYREEKVQKATIRIETTPGLSAQVDWKENVKMvsrdgeVFYFNIFLYILGYS 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890093 209 SLS-FAHARWSGTLPDWIECHLLALETFG-GAPALLVPDNAKVAVIKAC----HFDPQVNRTYTGMATHYGSAVLPTRPR 282
gi 15890128 153 DGC-YVRAYPAAVSEAWVDGHIHAFAFFR-AVPQSIVYDNDRCLVAKILp---DGTRKRAALFSGFLSHYLIRDRYGRPG 227
gi 15616527 159 RQKyMEWQARPFTTRDAIRCHEHAFQFYG-GRTEEIVYDQDHLIAVSEN----AGQLLLTTEFQHYVNEREFNVHLCRKA 233
gi 15803508  55 --------GIAWPLPDSVSLAQLDAILYA-NRKKELTEPQISEGTwrkerrtsysrefkirlvkqalqpgavvariareh 125
gi 15842491  77 --------VIAERIGWERSIRVLSARVAE-LRPVYLPPDPASRTTYVAG----EIAQCDFWFPP-IELPVGFGQTRTAKQ 142
gi 2497387  149 LVD-PARARKPKDKPRVERPMTYVRDSFWkGREFDSLAQMQQAAVTWSTevagLRYLRALEGAQPLRMFEAVEQQALIAL 227
gi 15610773  79 VHP-VAIGRRIEITADLSRVRVWCGGTLV-ADHDRIWAKHQTISDPEHVva-aKLLRRKRFDIVGPPHHVEVEQRLLTTY 155
gi 15927380  64 RQS-IIDKYYPIIEKLLSDSSEQKFYYKL-ILWQYLKDKHGLTCAYSTFrayiLKHDEFNRYFMKGYQRLSPKGKTRFET 141
gi 16262873 164 IAA-HRRSSGNGKHTTIPDHMPSAHRRFAdWTIERIEREASAMGPDVALlc-eRILADRPHPEQGFRACLGIIRLNKSFG 241
gi 18450289 155 RMK-YLELTFDRTQPTVFQCLVNAFEYCGnGIPQEIWFDNMKTVVDRSKs--qFTQTVFNEKFRQFAKDAGFHPIACRPF 231
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 15890093 283 RPRDKAKVEAAVRIVERWLLGRlRHrvf---ysLADVNKAIGELLHDLNDKRvLRRIGRTRRQLFE 345
gi 15890128 228 KGNDKGNVEGLVGYARRNFMVPiPQf-------pTWEAFNVWLEEQCRKRQRdKLRGESETIGERL 286
gi 15616527 234 DPESKGMIENVVKYIKGNFADSrVFs-------D-IEDWNSRALQWLQRTGNhQVHQTTKKRPAEV 291
gi 15803508 126 gindnlllkwksqyedgllsdddiqecmpvpvaltdtpeptrpvtnpfwrnkpdecpesdpgnvpr 191
gi 15842491 143 LPVLTMVCAYSRWLLAMLLPSRcAEdlfagwwrLIEALGAVPRVLVWDGEGAiGRWRGGRSELTTE 208
gi 2497387  228 PPRAFELTSWSIGTVGVDTHLKvGKalysvpwrLIGQRLHARTAGDVVQIFAgNDVVATHVRRPSG 293
gi 15610773 156 DTVLGLDGPVA------------------------------------------------------- 166
gi 15927380 142 KASHQAQFDWKEGINFKTKDNQmVL----------------------------------------- 166
gi 16262873 242 RDRVNAACGRALEIGARTYGSvr---------sILDNHLDRTAASNGAAPHEpIHHANIRGPRYYH 298
gi 18450289 232 RPQTKGKVEALARTVERLMVFNyEFtd-----vQELKQIIYELMQDLNGSVSqAIHNKPTVLLKEE 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap