Conserved Protein Domain Family
PksG

?
COG3425: PksG (this model, PSSM-Id:33231 is obsolete and has been replaced by 225959)
3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism]
Statistics
?
PSSM-Id: 33231
View PSSM: COG3425
Aligned: 27 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1708241   47 QNVGIKGIQIYIPTQCVNQSELEKFDGV-SQGKYTIGLGQTNMSFVNDREDIYSMSLTVLSKLIKSYNIDTNKIGRLEVG 125 baker's yeast
11497654   4 MKNNGGGCLAYISDCSVYLPVWKLKRDE-ISKETGMPSMGGERAVAHWDEDSITMAVEAARKFDG------AFD-AVIFA 75  Archaeoglobus fulgidus
730331     1 ---------------------------------------------------------------------------MLITC 5   Bacillus subtilis
16125680   1 -MVGIAAWGAYAPRLRLSRKAVTEANAW--VAPNLKAKGKGERSMANWDEDALTMAVEAARDALG-PDDDRSHIASLYFA 76  Caulobacter crescen...
19074660   5 NMFGIIGVEYQLPSLYISQEEVANNIDF-EVDKIKIGLGLEQMGVPSRREDAISLALNAVSRLMKRYNVDPMAIGRLEVG 83  Encephalitozoon cun...
15925742     -------------------------------------------------------------------------------- Staphylococcus aure...
15897459   1 MLSGILGWGAYIPRYRIKVEDIAKMWG--YDEAVVKSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDTSKIRLVLFG 78  Sulfolobus solfatar...
13540961   1 -MSGIVTYGSYIPRYRIKPDEIARVWGE-NPERIKNGIFILSKSVPAPDEDVATISVEAARNALKRKKINPKEIGAIYVG 78  Thermoplasma volcanium
15790573   2 TSVGIDAIEIHTGKLKLDLAETFAPEMGdDPEKYTKGLGLHASSFPDAYEDIVTMGANAAHRLLERKGLEPADVGRIDVA 81  Halobacterium sp. N...
16121732   2 NSIGIEKISIYPSSLALKLSELAQARGG-DNKYIQESLMVIKRSLVPQWEDAVTLAVNSAKDMLN--DQDRSDIGLFIIA 78  Yersinia pestis
1708241  126 TETLIDKSKSVKSVLM-----QLFGENTDVEGIDTLNACYGGTNALFNSLNWIESNAWDgrDAIVVCGDIAIYDKG---- 196 baker's yeast
11497654  76 SSSPPFRIKQCASFIA-----SALDLPDSTFTMDITDTMRAATDALITANEFVDSGRFS--RVLVVAGDKIPTKPGt--- 145 Archaeoglobus fulgidus
730331     6 SESGIDFGKSLSTYIH-----EYLGLNRNCRLFEVKQACYSGTAGFQMAVNFILSQTSPgaKALVIASDISRFLIAeggd 80  Bacillus subtilis
16125680  77 STTAPFADRLNAGIVS-----AALTLEKSITASDVTGSQRCGLTALGQALAAGGTALVA------VGERRKARAVS---- 141 Caulobacter crescen...
19074660  84 TESNPDGSKSIKSYLT-----DLFPGNTSICGCDNVHACYSGTNALLSAIAWMESSFWDgrLAIVVASDVAMYKDK---- 154 Encephalitozoon cun...
15925742     -------------------------------------------------------------------------------- Staphylococcus aure...
15897459  79 SESKVYAVKPTSTILI-----DALGINNYSATADMEFACRAASVGLRLASSFVLHNNDS--YALVIGADTAQSNPGd--- 148 Sulfolobus solfatar...
13540961  79 SESHPYAVKPTATIVG-----SAIGVDFSLFAADYEFACKAGTAGMQNVKAMVDAGMIK--YGLAIGADTSQGAPGd--- 148 Thermoplasma volcanium
15790573  82 TESAFDNSKPVSTYIAgcleqVYDGDFHHANKGERKFACIAGTQSLDDAVNWILAGRNRgrGALVIATDTALYARDs--- 158 Halobacterium sp. N...
16121732  79 TESGLDQEKAISTWAH-----RYLGLPATCRVFELKSACHAGAAALKMAESWISSGLNRgkKVLLINVDISNNMICh--- 150 Yersinia pestis
1708241  197 -------AARPTGGAGTVAMWIGPD--APIVFDS-VRASYMEHAYDFYKPDFTsEYPYVDGHFS-LTCYVKALDQVYKSY 265 baker's yeast
11497654 146 -------LYEQLYGDAAAAVVVEK---EGGAKIL-GYSTSTKPLPGSWMLADDdTVRDYDMRVDaRYGYAASVQKAAMPL 214 Archaeoglobus fulgidus
730331    81 alsedwsYAEPSAGAGAVAVLVGENp-EVFQIDPgANGYYGYEVMDTCRPIPD--SEAGDSDLS-LMSYLDCCEQTFLEY 156 Bacillus subtilis
16125680 142 -------AQELDFGDGAAAFVISD---GPGAAEFlGRGSVTDDFVDHFRGDDGgFDYYWEERWIrDEGIVKLVPPAIRKA 211 Caulobacter crescen...
19074660 155 -------SCQPTGGAGAVAILLGPN--CIYRVVPsSVIHYFTNQFDFMKPRELhPFPVVKGKES-IENYRTAFEICYGRF 224 Encephalitozoon cun...
15925742     -------------------------------------------------------------------------------- Staphylococcus aure...
15897459 149 -------VLELSSAAAGVAFVVGKTdeKHSAAVIeYSSSYTSDTPDFWRRDGT-PYPVHGEGFTgEPAYFHHIISAVNDL 220 Sulfolobus solfatar...
13540961 149 -------ALEYSASAGGSAFIIGK---DDVIAEInSTLSVASDTPDFWRREGQ-PYPSHGERFTgEPAYFRHVVNAAKMM 217 Thermoplasma volcanium
15790573 159 -------SGEATQGAGAVAMWITED--PDIVELStEQGYGSADETDFLKPNQQ--FPSVDGKRS-MQVYLARMRESLQDF 226 Halobacterium sp. N...
16121732 151 ------gKMEYSLGAGAIALLISDNp-VFAVIETgKSGIHTHEVTDVIRPLPW-KEVAFDVEAS-LFSYMDGLENAFEEY 221 Yersinia pestis
1708241  266 SKKAISKglvsdpagsdalnvLKYFDYNVFHVPTCKLVTKSYGRLLYNdfranpqlfpevdae---------latrdyde 336 baker's yeast
11497654 215 FAKLGLS--------------PADIDRIVASAPDPKSYQGLLKAVGAR-------------------------------- 248 Archaeoglobus fulgidus
730331   157 QKRVPGAn------------yQDTFQYLAYHTPFGGMVKGAHRTMMRKv------------------------------- 193 Bacillus subtilis
16125680 212 LEVSGLS--------------ASDVDHFCFPSTFSGMAATVAKSVGIKp------------------------------- 246 Caulobacter crescen...
19074660 225 REKMAEE---------------SSFDYIVLHSPYTRLPEKICIANHIDr------------------------------- 258 Encephalitozoon cun...
15925742     -------------------------------------------------------------------------------- Staphylococcus aure...
15897459 221 LQNSGLK--------------ISDFDYFVFHQPNGKFPIQVAKKLGVP-------------------------------- 254 Sulfolobus solfatar...
13540961 218 MERMETQ--------------PKDYDYVVFHQPNGKFPTRAAKLLGFE-------------------------------- 251 Thermoplasma volcanium
15790573 227 ERATGASh-------------PDDYAFIPFHTPFPGMVRKAAVLGYRHmirgtdieeelaadigrqprrerfdsddafed 293 Halobacterium sp. N...
16121732 222 CHQTPEAr------------eSTYFNYNLYHVPFPGISKEAHKVLLELqglfgke------------------------- 264 Yersinia pestis
1708241  337 sltdkniEktfvnvakpfhkERVAQSLIVPTNTGNMYTASVYAAFASLLNYVGsd--dLQGKRVGLFSYGSGLAASLYSC 414 baker's yeast
11497654 249 ------------------------PEEFYFDSVGIAGSAHPLLLLATQLEREG---------RILLGGYGEGADVIAVEI 295 Archaeoglobus fulgidus
730331   194 -------AkvktsgietdflTRVKPGLNYCQRVGNIMGAALFLALASTIDQGRf----DTPKRIGCFSYGSGCCSEFYSG 262 Bacillus subtilis
16125680 247 --------------------EAVRDNLAAL--MGEAGCAHGPIMLAHALEQAK------AGEIILVAQFGQGAEALVFRA 298 Caulobacter crescen...
19074660 259 --------------------KKLLRSLEASRRNGNAYSASLYLSLISLLECHDg----EVGEKILMFSYGSGASSSMFC- 313 Encephalitozoon cun...
15925742   1 -----------------------------------MYTGSLYLSLISLLQNHTf----QPEEKVCLFSYGSGAVGEIFSG 41  Staphylococcus aure...
15897459 255 -------L------------EKVKQGLVSP-YIGNPYNASALLGLAKVLDIAK------PGERILVAPFGSGAGSDAFSI 308 Sulfolobus solfatar...
13540961 252 -------E------------KQYKDGLITP-YIGNTYSGSMMTGLSSILDVSK------PGDHILAVSFGSGAGSDAFDI 305 Thermoplasma volcanium
15790573 294 aiseyvdGltdtdayrewydAAIQPTLSISSQVGNWYTGSVHLARFSALKHAAengidLAGKRLLVASYGSGAQAEIHSE 373 Halobacterium sp. N...
16121732 265 -------------alatsfkQKVMPSLYYAQKIGATYCGSIFLSLFSLMVKAPe---iKSGDRIGVYSYGSGSCAEYFSM 328 Yersinia pestis
1708241  415 KIVGDVQHIIKEL--DITNKLAKRITETPKDYEAAIELRENAHLKKNFKPqgs-------iehLQSGVYYLTNIDDKFRR 485 baker's yeast
11497654 296 EQAMDSNMGR---------MLESRKEISYGDYLFnrgfvgvrdapdrpsltkfwrdeksiirfygmkckscgtvsypisr 366 Archaeoglobus fulgidus
730331   263 ITTPQGQERQRTF--GIEKHLDRRYQLSMEEYELLFKGSGMVRFGTRNVKldfemipgimqstQEKPRLFLEEISEFHRK 340 Bacillus subtilis
16125680 299 TGEGTRPARGVTG--SLADREVETNYLKFLTFNGLVDWEKGMRAEKDNKTalt--------tlYRNEDMILGlvggrcre 368 Caulobacter crescen...
19074660 314 --LERISKGCMVT--GFRERLLERKEISYQEFTKILEEPVPQDNYEAQER-------------IYSPGYYLKRISSFARY 376 Encephalitozoon cun...
15925742  42 SIVKGYDKALDKE--KHLNMLESREQLSVEEYETFFNRFDNQEFDFERELt-----------qDPYSKVYLYSIEDHIRT 108 Staphylococcus aure...
15897459 309 LVSEGILAKQ-KL--AKTVEYYINNKK-LVSYAEYAKYTNKIKVYE---------------------------------- 350 Sulfolobus solfatar...
13540961 306 TVTDRIEEMDRNK--APTIKKMLEKIK-WVDYAIYAKYKKKIVLGDGIE------------------------------- 351 Thermoplasma volcanium
15790573 374 TVQDGFTEAVAAS--TIDEQIEQRYDISFAEYEQVHDRHNHEKSVELEPFtq-----------pDAEFVFDGWGPMNERK 440 Halobacterium sp. N...
16121732 329 QVGDQAVEIAQQQgaALDILLTQRKILDVAAYEQLENARSAQMQGKDYRLdgdnlqdwythhySGSGLLILERIDNHLRR 408 Yersinia pestis
1708241  486 SYDV 489 baker's yeast
11497654 367 ccie 370 Archaeoglobus fulgidus
730331   341 YRWI 344 Bacillus subtilis
16125680 369 tgvi 372 Caulobacter crescentus CB15
19074660 377 YEYL 380 Encephalitozoon cuniculi
15925742 109 YKIE 112 Staphylococcus aureus subsp. aureus N315
15897459     ---- Sulfolobus solfataricus
13540961     ---- Thermoplasma volcanium
15790573 441 YTYV 444 Halobacterium sp. NRC-1
16121732 409 YRYA 412 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap