Conserved Protein Domain Family
BcsA

?
COG3424: BcsA (this model, PSSM-Id:33230 is obsolete and has been replaced by 225958)
Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]
Statistics
?
PSSM-Id: 33230
View PSSM: COG3424
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Oct-2002
Updated: 7-Oct-2002
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15807986  67 TAYLISAATAVPGTAYPQTLIRDLLRAQPQMDRlaQRLIPSAFN---ASGIDTRYSVIPDYLgaggpffdavsgQMLSPG 143 Deinococcus radiodu...
15613180   1 MASIVSVSSYPPPYLLKQ-ETTTEFAKELFQED--FRDIERLLKsfsNGQIEERQFAVPLDW------------FRQDHS 65  Bacillus halodurans
1705445    1 MAFILSIGTSLPAYNVNQ-EKAAEFARYMFQHS--FKDIDRLLSsfkNGQIHSRQFVKPIEW------------YKEGHS 65  Bacillus subtilis
15807085   9 APLLRSLVTGTPPYSALQSEVQAAARTLFPRMSe-RRHMLDVFT---NAQIERRALSRPLAW------------YLEPHG 72  Deinococcus radiodu...
15840830  32 VAVIEGLATGTPRRVVNQSDAADRVAELFLDPGq-RERIPRVYQk--SRITTRRMAVDPLDAkfd-------vfRREPAT 101 Mycobacterium tuber...
15841116   1 MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEG--YEDIVRQLHa--SAKVNSRHLVLPLEK------------YPKLTD 64  Mycobacterium tuber...
15841121   1 MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKE--HEEIIRRLHa--AAKVNGRHLVLPLQQ------------YPSLTD 64  Mycobacterium tuber...
15608512  32 VAVIEGLATGTPRRVVNQSDAADRVAELFLDPGq-RERIPRVYQk--SRITTRRMAVDPLDAkfd-------vfRREPAT 101 Mycobacterium tuber...
15608798   1 MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEG--YEDIVRQLHa--SAKVNSRHLVLPLEK------------YPKLTD 64  Mycobacterium tuber...
15608803   1 MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKE--HEEIIRRLHa--AAKVNGRHLVLPLQQ------------YPSLTD 64  Mycobacterium tuber...
15807986 144 TGLRNEVYTREVTPLFIDAGRRALEG-----SGLAPEDITHVVTVSCTGFFAPGPDYLVVRALGLPATTQRFHVGFMGCY 218 Deinococcus radiodu...
15613180  66 LQEKNDTYIKLATMFSVEVVRQCLQSnvflkKPVAEEEIDTIVFVSSSGMATPSIEARMMNELPFSPHTKRVPMWGLGCA 145 Bacillus halodurans
1705445   66 FEEKNQIYIEETLKHSRAAVRECLSHpeffqEAIPYEKVEAVFFVSSTGLSTPSIEARLMNELPFSPYTKRIPIWGLGCA 145 Bacillus subtilis
15807085  73 FAEKNGVFLEEARALIVRLAREALDK-----AELAPADVDAVVVVNTSGLSTPSLDAYLIGALGLNPHAARLPVWGLGCA 147 Deinococcus radiodu...
15840830 102 IRDRMHLFYEHAVPLAVDVSKRALAG-----LPYRAAEIGLLVLATSTGFIAPGVDVAIVKELGLSPSISRVVVNFMGCA 176 Mycobacterium tuber...
15841116  65 FGEANKIFIEKAVDLGVQALAGALDE-----SGLRPEDLDVLITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCV 139 Mycobacterium tuber...
15841121  65 FGDANEIFIEKAVDLGVEALLGALDD-----ANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCV 139 Mycobacterium tuber...
15608512 102 IRDRMHLFYEHAVPLAVDVSKRALAG-----LPYRAAEIGLLVLATSTGFIAPGVDVAIVKELGLSPSISRVVVNFMGCA 176 Mycobacterium tuber...
15608798  65 FGEANKIFIEKAVDLGVQALAGALDE-----SGLRPEDLDVLITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCV 139 Mycobacterium tuber...
15608803  65 FGDANEIFIEKAVDLGVEALLGALDD-----ANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCV 139 Mycobacterium tuber...
15807986 219 AAFPALRMARAFCDADPQANVLVICAELCTLHVKVSPDPD-DIVSSAVFADGAAAVVVSA---QPPVTGRTALRFDAFET 294 Deinococcus radiodu...
15613180 146 GGAAGMSRAYEYCRAFPRANVLVVCVELCSLTFQRQDRTKsNLIGASLFSDGVACALVSGdesDVLGRMKMPTRPLILGS 225 Bacillus halodurans
1705445  146 GGASGLARAAEYCKAYPEAFVLVISAELCSLTFQPEDKTKsNLIGTSLFGDGIAAALLCGekaDRR-VSKLKLAPKIMDA 224 Bacillus subtilis
15807085 148 GGASGLARAADLVRAG-FKRVLYVAVELCSLTLVKGDESKsNFVGTALFADGGAALVVTAp--DVP--GPRPLLA-LHGG 221 Deinococcus radiodu...
15840830 177 AAMNALGTATNYVRAHPAMKALVVCIELCSVNAVFADDIN-DVVIHSLFGDGCAALVIGA---SQVQEKLEPGKVVVRSS 252 Mycobacterium tuber...
15841116 140 AGAAGVARLHDYLRGAPDGVAALVSVELCSLTYPGYKPTLpGLVGSALFADGAAAVVAAG---VKRAQDIGADGPDILDS 216 Mycobacterium tuber...
15841121 140 AGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVsSLVGTALFGDGAAAVVAVG---DRRAEQVRAGGPDILDS 216 Mycobacterium tuber...
15608512 177 AAMNALGTATNYVRAHPAMKALVVCIELCSVNAVFADDIN-DVVIHSLFGDGCAALVIGA---SQVQEKLEPGKVVVRSS 252 Mycobacterium tuber...
15608798 140 AGAAGVARLHDYLRGAPDGVAALVSVELCSLTYPGYKPTLpGLVGSALFADGAAAVVAAG---VKRAQDIGADGPDILDS 216 Mycobacterium tuber...
15608803 140 AGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVsSLVGTALFGDGAAAVVAVG---DRRAEQVRAGGPDILDS 216 Mycobacterium tuber...
15807986 295 ALTPPDQGEKDMAWTIGDQGYQMVLSSYVPRLIETHLHGAVGPLLHTLPgelaQAGEHIEHWAVHPGGRSILDKVEGSLG 374 Deinococcus radiodu...
15613180 226 SSTLMPDSEQVMGWDVKDTGLHVVFSRDIPNIIRHWLRPNVERFLETYR----LSLEQIEAFIAHPGGRKVLEAYEEALS 301 Bacillus halodurans
1705445  225 QSVLMKQSEDVMGWDFTDQGFKVIFSRDIPTLVEKWLKTNVQIFLDKHK----LSFHDISVFLAHPGGKKVIDAYIKSLG 300 Bacillus subtilis
15807085 222 FSTLIEDSEDIMGWDVVDDGLKVRFSRDIPTLVNSMMQENVAQALAAQG----WARDDVQTFVVHPGGVKVVAAYEQALG 297 Deinococcus radiodu...
15840830 253 FSQLLDNTEDGIVLGVNHNGITCELSENLPGYIFSGVAPVVTEMLWDNG----LQISDIDLWAIHPGGPKIIEQSVRSLG 328 Mycobacterium tuber...
15841116 217 RSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVEQYLGNDVTTFLASHG----LSTTDVGAWVTHPGGPKIINAITETLD 292 Mycobacterium tuber...
15841121 217 RSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHR----LTKDDIGAWVSHPGGPKVIDAVATSLA 292 Mycobacterium tuber...
15608512 253 FSQLLDNTEDGIVLGVNHNGITCELSENLPGYIFSGVAPVVTEMLWDNG----LQISDIDLWAIHPGGPKIIEQSVRSLG 328 Mycobacterium tuber...
15608798 217 RSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVEQYLGNDVTTFLASHG----LSTTDVGAWVTHPGGPKIINAITETLD 292 Mycobacterium tuber...
15608803 217 RSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHR----LTKDDIGAWVSHPGGPKVIDAVATSLA 292 Mycobacterium tuber...
15807986 375 LSETQMHASREELRRYGNMSSATVLFILRDLLEE---VRDGERVCAMAFGPGLTVESGLMTAVGAS 437 Deinococcus radiodurans
15613180 302 FSDEMTEYSRDILRHHGNMSSPTVLYVLEKFMKDt--RDPGQYGLMAALGPGFCSELVLMQWEAVH 365 Bacillus halodurans
1705445  301 LSSEKLSSAQSILQKHGNMSSATILYVIKDHLQNg-hKKEAERGLIGALGPGFSSELLLFSWEKGA 365 Bacillus subtilis
15807085 298 LPDGTLDSSRAVLREYGNMSSATVLFVLEEVLRS----RPQGRGLLSAMGPGFSAEHVLLDFGGGE 359 Deinococcus radiodurans
15840830 329 ISAELAAQSWDVLARFGNMLSVSLIFVLETMVQQaesAKAISTGVAFAFGPGVTVEGMLFDIIRR- 393 Mycobacterium tuberculosis CDC1551
15841116 293 LSPQALELTWRSLGEIGNLSSASVLHVLRDTIAKp--PPSGSPGLMIAMGPGFCSELVLLRWH--- 353 Mycobacterium tuberculosis CDC1551
15841121 293 LPPEALELTWRSLGEIGNLSSASILHILRDTIEKr--PPSGSAGLMLAMGPGFCTELVLLRWR--- 353 Mycobacterium tuberculosis CDC1551
15608512 329 ISAELAAQSWDVLARFGNMLSVSLIFVLETMVQQaesAKAISTGVAFAFGPGVTVEGMLFDIIRR- 393 Mycobacterium tuberculosis H37Rv
15608798 293 LSPQALELTWRSLGEIGNLSSASVLHVLRDTIAKp--PPSGSPGLMIAMGPGFCSELVLLRWH--- 353 Mycobacterium tuberculosis H37Rv
15608803 293 LPPEALELTWRSLGEIGNLSSASILHILRDTIEKr--PPSGSAGLMLAMGPGFCTELVLLRWR--- 353 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap